viHumans
Reviewed
Calomys Callosus (Large Vesper Mouse) [TaxID: 56210]; Chlorocebus Aethiops (Green Monkey) (Cercopithecus Aethiops) [TaxID: 9534]; Homo Sapiens (Human) [TaxID: 9606]
GPC GP-C
♦Pre-glycoprotein polyprotein GP complex (Pre-GP-C) [Cleaved into: Stable signal peptide (SSP)
♦ Glycoprotein G1 (GP1)
♦ Glycoprotein G2 (GP2)]
Machupo Virus (MACV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Arenaviridae> Mammarenavirus> Machupo Virus (MACV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MGQLISFFQEIPVFLQEALNIALVAVSLIAVIKGIINLYKSGLFQFIFFLLLAGRSCSDGTFKIGLHTEFQSVTLTMQRLLANHSNELPSLCMLNNSFYY
MKGGVNTFLIRVSDISVLMKEHDVSIYEPEDLGNCLNKSDSSWAIHWFSNALGHDWLMDPPMLCRNKTKKEGSNIQFNISKADDVRVYGKKIRNGMRHLF
RGFHDPCEEGKKCYLTINQCGDPSSFDYCGMDHLSKCQFDHVNTLHFLVRSKTHLNFERSLKAFFSWSLTDSSGKDMPGGYCLEEWMLIAAKMKCFGNTA
VAKCNQNHDSEFCDMLRLFDYNKNAIKTLNDESKKEINLLSQTVNALISDNLLMKNKIKELMSIPYCNYTKFWYVNHTLTGQHTLPRCWLIRNGSYLNTS
EFRNDWILESDHLISEMLSKEYAERQGKTPITLVDICFWSTVFFTASLFLHLVGIPTHRHLKGEACPLPHKLDSFGGCRCGKYPRLRKPTIWHKRH
496
Not Available
Not Available
05-07-2004
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
♦Glycoprotein G2: class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome.
♦ Stable signal peptide (SSP): cleaved and functions as a signal peptide. In addition, it is also retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.
♦ Glycoprotein G1: interacts with the host receptor (By similarity). Mediates virus attachment to host TFRC. This attachment induces virion internalization predominantly through clathrin-mediated endocytosis (PubMed:17287727).
Not Available
GO:0016021  ;   GO:0019031  ;   GO:0019062  ;   GO:0020002  ;   GO:0039654  ;  
GO:0044167  ;   GO:0044178  ;   GO:0046872  ;   GO:0055036  ;   GO:0075509  
♦ Glycoprotein G1: Virion membrane
♦ Peripheral membrane protein . Host endoplasmic reticulum membrane
♦ Peripheral membrane protein . Host Golgi apparatus membrane
♦ Peripheral membrane protein . Host cell membrane
♦ Peripheral membrane protein .
♦ Glycoprotein G2: Virion membrane
♦ Single-pass membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass membrane protein . Host Golgi apparatus membrane
♦ Single-pass membrane protein . Host cell membrane
♦ Single-pass membrane protein . Note=Binding to the stable signal peptide masks endogenous ER localization signals in the cytoplasmic domain of G2 to ensure that only the fully assembled, tripartite GP complex is transported for virion assembly. .
♦ Stable signal peptide: Virion membrane
♦ Multi-pass membrane protein . Host endoplasmic reticulum membrane
♦ Multi-pass membrane protein . Host Golgi apparatus membrane
♦ Multi-pass membrane protein . Host cell membrane
♦ Multi-pass membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available