viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Sus Scrofa (Pig) [TaxID: 9823]
M[Gene ID: 3077361;3077362 ]
♦Polyprotein p42 [Cleaved into: Protein M1' (CM1') (p31)
♦ Protein CM2]
Influenza C Virus (strain C/Ann Arbor/1/1950)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Gammainfluenzavirus> Influenza C Virus> Influenza C Virus (strain C/Ann Arbor/1/1950)
Various pathway(s) in which protein is involved
Not Available
MAHEILIAETEAFLKNVAPETRTAIISAITGGKSACKSAAKLIKNEHLPLMSGEATTMHIVMRCLYPEIKPWKKASDMLNKATSSLKKSEGRDIRKQMKA
AGDFLGVESMMKMRAFRDDQIMEMVEEVYDHPDDYTPDIRIGTITAWLRCKNKKSERYRSNVSESGRTALKIHEVRKASTAMNEIAGITGLGEEALSLQR
QTESLAILCNHTFGSNIMRPHLEKAIKGVEGRVGEMGRMAMKWLVVIICFSITSQPASACNLKTCLKLFNNTDAVTVHCFNENQGYMLTLASLGLGIITM
LYLLVKIIIELVNGFVLGRWERWCGDIKTTIMPEIDSMEKDIALSRERLDLGEDAPDETDNSPIPFSNDGIFEI
374
VAR_SEQ 243 374 Missing (in isoform M1)
Not Available
09-01-2007
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Ion channel, which might have a role in genome packaging and uncoating processes.
Not Available
GO:0005216  ;   GO:0016021  ;   GO:0019028  ;   GO:0020002  ;   GO:0039660  ;  
GO:0039707  ;   GO:0044167  ;   GO:0044385  ;   GO:0051259  ;   GO:0055036  
♦ Polyprotein p42: Host endoplasmic reticulum membrane
♦ Multi-pass membrane protein .
♦ Protein M1': Virion membrane
♦ Single-pass type II membrane protein .
♦ Protein CM2: Virion membrane
♦ Single-pass type I membrane protein . Host cell membrane
♦ Single-pass type I membrane protein .
Not Available
Not Available
X-ray crystallography (1)
5M1M  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available