viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
U23 EqLF1[Gene ID: 1487989 ]
Glycoprotein U23
Human Herpesvirus 6A (strain Uganda-1102) (HHV-6 Variant A) (Human B Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Betaherpesvirus 6A> Human Herpesvirus 6A (strain Uganda-1102) (HHV-6 Variant A) (Human B Lymphotropic Virus)
Not Available
Various pathway(s) in which protein is involved
Not Available
MLFLSFLLVCLCEEVRMLNLMTTEVSATEFASIASKNMETDVSTSSDYLTGKSETTFSANSETWGKNVTEISIDSETYLNQSFMVTSTLAVETTDRSIGN
NVNVTSSFPTVKGDETQNIETSFTVISASTFSDVSEKTPQGLSTKSTPKKTVQALWETDTVQVLEFTDTHEGDEEYFKDFLSSLVIWIGGISFIGAFVIL
IVILCNWYKKDKQRSLFWDEEKKPDVQMRRDVKTCR
236
Not Available
Not Available
01-11-1996
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Not Available
Not Available
♦ Membrane
♦ Single-pass membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available