Reviewed
Homo Sapiens (Human) [TaxID: 9606]
EBNA2 BYRF1[Gene ID: 5176198 ]
Epstein-Barr nuclear antigen 2 (EBNA-2) (EBV nuclear antigen 2)
Epstein-Barr Virus (strain AG876) (HHV-4) (Human Herpesvirus 4)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Lymphocryptovirus> Epstein-Barr Virus (strain GD1) (HHV-4) (Human Herpesvirus 4)> Epstein-Barr Virus (strain AG876) (HHV-4) (Human Herpesvirus 4)
Various pathway(s) in which protein is involved
Not Available
MPTYYLALHGGQSYNLIVDTDMSGNPSLSVIPTNPYQEQLSNNPLIQLQIVVGENTGAPAPPQPPPPPPPPPPPERRDAWTQEPLPLDMNPLGSDASQGP
LASSIRMLCMAQYLLRNARGQQGLLRPLGPQTRSQVTLERQPVHNPRQEAPIILLQSPAPPRFTPVPMVALGHTLQPTPPPRPTLPQPRIPLIIPPRHTN
QPATTPPTAPQRLTLGHQLSLPPHPPPHQSTPHCSSDSTGLPPPPTSYSIPSMTLSPEPLPPPAAPAHPLPGVIYDQQALPPTPGPPWWPPVRDPTPTTQ
TPPTNTKQGPDQGQGRGRWRGRGRSKGRGRMHKLPEPRRPGPDTSSPSMPQLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPDISPIHEPESSDS
EEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPRTSTQ
LASSIRMLCMAQYLLRNARGQQGLLRPLGPQTRSQVTLERQPVHNPRQEAPIILLQSPAPPRFTPVPMVALGHTLQPTPPPRPTLPQPRIPLIIPPRHTN
QPATTPPTAPQRLTLGHQLSLPPHPPPHQSTPHCSSDSTGLPPPPTSYSIPSMTLSPEPLPPPAAPAHPLPGVIYDQQALPPTPGPPWWPPVRDPTPTTQ
TPPTNTKQGPDQGQGRGRWRGRGRSKGRGRMHKLPEPRRPGPDTSSPSMPQLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPDISPIHEPESSDS
EEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPRTSTQ
454
Not Available
Not Available
01-11-1996
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a key role in the activation of the host resting B-cell and stimulation of B-cell proliferation. Acts by up-regulating the expression of viral EBNA1-6, LMP1, LMP2A and LMP2B genes, as well as several host genes including CD21, CD23 and MYC. Activates transcription by acting as an adapter molecule that binds to cellular sequence-specific DNA-binding proteins such as host CBF1, SMARCB1 and SPI1. Once EBNA2 is near promoter sites, its acidic activating domain recruits basal and activation-associated transcription factors TFIIB, TAF40, TFIIH components ERCC2 and ERCC3, and CBP in order to promote transcription. Alternatively, EBNA2 can affect activities of cell cycle regulators and retard cell cycle progression at G2/M phase. It also induces chromosomal instability, by disrupting mitotic checkpoints, multi-nucleation and formation of micronuclei in infected cells (By similarity).
Not Available
Host nucleus matrix. Note=Associated with the nuclear matrix. .
Not Available
MOTIF 350 354 PXLXP motif, interaction with host ZMYND11. ; MOTIF 404 408 PXLXP motif, interaction with host ZMYND11.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available