viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF2[Gene ID: 5176813 ]
Protein VP2 (Minor capsid protein)
Sapporo Virus (isolate GI/Human/Germany/pJG-Sap01) (Hu/Dresden/pJG-Sap01/DE)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Caliciviridae> Sapovirus> Sapporo Virus> Sapovirus Isolates> Sapporo Virus (isolate GI/Human/Germany/pJG-Sap01) (Hu/Dresden/pJG-Sap01/DE)
Not Available
Various pathway(s) in which protein is involved
Not Available
MSWLVGALQTFGSLADVAGTVSNIVYQQRQAAQLEKQNELMETWMNKQEALQKSQMELTRDLSINGPAARVQSALDAGFDEVSARRIAGSGERVIWGNLD
RPIMHAGTMDSIRQTRHLDSLSHSLATFKNGTPFGKPAPPTAKSGRPQATTAQITIGHNPGSTSV
165
Not Available
Not Available
11-10-2004
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Minor structural protein present in one or two copies per virion. Does not seem to play a role in capsid assembly, but is essential for production of infectious virus (By similarity).
Not Available
Virion. Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available