♦Genome polyprotein [Cleaved into: Protein VP0 (VP4-VP2)
♦ Protein VP4 (P1A) (Virion protein 4)
♦ Protein VP2 (P1B) (Virion protein 2)
♦ Protein VP3 (P1C) (Virion protein 3)
♦ Protein VP1 (P1D) (Virion protein 1)] (Fragment)

Not Available

MGAQVSTQKTGAHETLLEAAQGATINYTNINYYKDAASNSANRQDFSQDPSKFTEPVKDIMIKSMPALNSPSAEECGYSDRVRSITLGNSTITTQESANV
VVAYGRWPKYLEDDQATAEDQPTQPDVATCRFYTLESVQWEANSAGWWWKFPEALKDMGLFGQNMYYHYLGRAGYTIHVQCNASKFHQGCLLVVCVPEAE
MGCAKPDENVDATNLTNGENTCELTAGAAPAEKGKVQTAVCNATMGVAVGNLTIFPHQWINLRTNNCATIVMPYINSVPMDNMFRHYNFTLMVIPFVPLT
SMGGSTYVPITVTIAPMCAEYNGLRLSTQHQGLPVMNVPGSNQFLTSDNFQSPCAMPEYDVTPPLDIPGEVNNLMEVAEVDSVVPVNNLSDNVKTIKAYQ
IPVSAGDSSRPEAVFKFQLDPGSGSVLKHTLLGEIINYYAHWSGSIKLTFVFCGSAMATGKLLIAYSPPGASAPATRKDAMLGTHIIWDLGLQSSCVLCV
PWISQTHYRMVERDEYTTAGYISCWYQTNIIVPPDTPSQCYMLCLASACNDFSVRMLKDTPFIQQEAKLQGEPGKAIESAISRVADTISSGPTNSEQVPA
LTAAETGHTSQVVPGDTIQTRHVKNYHSRSESTIENFLCRSACVHIARYEAGANASNEDRFVRWEINNKELVQLRRKCEMFTYLRYDVEVTFVITSQQDQ
GTDLSQDMPVLTHQVMYVPPGGSVTKQGDSYAWQTSTNPSVFWTEGNAPPRMSIPFISIGNAYSSFYDGWSHFSQKGVYGYNTLNKMGTLFVRHVNKETP
KPVTSTVRVYFKPKHIRAWIPRPPRLCPYKYKANVNFDVTAITDSRLTITTVPQVEHNLRTA

♦Protein VP1: Forms, together with VP2 and VP3, an icosahedral capsid (pseudo T=3), 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome. Protein VP1 mainly forms the vertices of the capsid. VP1 interacts with host cell receptor to provide virion attachment to target cell. After binding to its receptor, the capsid undergoes conformational changes. VP1 N-terminus (that contains an amphipathic alpha-helix) is externalized, VP4 is released and together, they shape a virion-cell connecting channel and a pore in the host membrane through which RNase-protected transfer of the viral genome takes place. After genome has been released, the channel shrinks (By similarity).
♦ Protein VP2: Forms, together with VP1 and VP3, an icosahedral capsid (pseudo T=3), 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome.
♦ Protein VP3: Forms, together with VP1 and VP2, an icosahedral capsid (pseudo T=3), 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome.
♦ Protein VP4: Lies on the inner surface of the capsid shell. After binding to the host receptor, the capsid undergoes conformational changes. VP4 is released, VP1 N-terminus is externalized, and together, they shape a virion-cell connecting channel and a pore in the host membrane through which RNase-protected transfer of the viral genome takes place. After genome has been released, the channel shrinks (By similarity).
♦ Protein VP0: Protein VP0: VP0 precursor is a component of immature procapsids, which gives rise to VP4 and VP2 after maturation. Allows the capsid to remain inactive before the maturation step (By similarity).

♦ Protein VP2: Virion. Host cytoplasm .
♦ Protein VP3: Virion. Host cytoplasm .
♦ Protein VP1: Virion. Host cytoplasm .

Not Available

Not Available