Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Mus Musculus (Mouse) [TaxID: 10090]; Sigmodon Hispidus (Hispid Cotton Rat) [TaxID: 42415]; Sus Scrofa (Pig) [TaxID: 9823]
Not Available
♦Genome polyprotein [Cleaved into: Leader protein
♦ Protein VP0 (VP4-VP2)
♦ Protein VP4 (P1A) (Rho) (Virion protein 4)
♦ Protein VP2 (Beta) (P1B) (Virion protein 2)
♦ Protein VP3 (Gamma) (P1C) (Virion protein 3)
♦ Protein VP1 (Alpha) (P1D) (Virion protein 1)
♦ Protein 2A (P2A) (G)
♦ Protein 2B (I) (P2B)
♦ Protein 2C (C) (P2C) (EC 3.6.1.15)
♦ Protein 3A (P3A)
♦ Protein 3B (P3B) (H) (VPg)
♦ Protease 3C (P3C) (EC 3.4.22.28) (Picornain 3C) (p22)
♦ RNA-directed RNA polymerase 3D-POL (E) (P3D-POL) (EC 2.7.7.48)]
♦ Protein VP0 (VP4-VP2)
♦ Protein VP4 (P1A) (Rho) (Virion protein 4)
♦ Protein VP2 (Beta) (P1B) (Virion protein 2)
♦ Protein VP3 (Gamma) (P1C) (Virion protein 3)
♦ Protein VP1 (Alpha) (P1D) (Virion protein 1)
♦ Protein 2A (P2A) (G)
♦ Protein 2B (I) (P2B)
♦ Protein 2C (C) (P2C) (EC 3.6.1.15)
♦ Protein 3A (P3A)
♦ Protein 3B (P3B) (H) (VPg)
♦ Protease 3C (P3C) (EC 3.4.22.28) (Picornain 3C) (p22)
♦ RNA-directed RNA polymerase 3D-POL (E) (P3D-POL) (EC 2.7.7.48)]
Encephalomyocarditis Virus (strain Rueckert) (EMCV)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Picornavirales> Picornaviridae> Cardiovirus> Cardiovirus A> Encephalomyocarditis Virus> Encephalomyocarditis Virus (strain Rueckert) (EMCV)
Various pathway(s) in which protein is involved
Not Available
MATTMEQETCAHSLTFEECPKCSALQYRNGFYLLKYDEEWYPEELLTDGEDDVFDPELDMEVVFELQGNSTSSDKNNSSSEGNEGVIINNFYSNQYQNSI
DLSANAAGSDPPRTYGQFSNLFSGAVNAFSNMLPLLADQNTEEMENLSDRVSQDTAGNTVTNTQSTVGRLVGYGTVHDGEHPASCADTASEKILAVERYY
TFKVNDWTSTQKPFEYIRIPLPHVLSGEDGGVFGAALRRHYLVKTGWRVQVQCNASQFHAGGLLVFMAPEYPTLDAFAMDNRWSKDNLPNGTRTQTNKKG
PFAMDHQNFWQWTLYPHQFLNLRTNTTVDLEVPYVNIAPTSSWTQHASWTLVIAVVAPLTYSTGASTSLDITASIQPVRPVFNGLRHETLSRQSPIPVTI
REHAGTWYSTLPDSTVPIYGKTPVAPSNYMVGEYKDFLEIAQIPTFIGNKIPNAVPYIEASNTAVKTQPLATYQVTLSCSCLANTFLAALSRNFAQYRGS
LVYTFVFTGTAMMKGKFLIAYTPPGAGKPTSRDQAMQATYAIWDLGLNSSYSFTVPFISPTHFRMVGTDQVNITNADGWVTVWQLTPLTYPPGCPTSAKI
LTMVSAGKDFSLKMPISPAPWSPQGVENAEKGVTENTNATADFVAQPVYLPENQTKVAFFYNRSSPIGAFTVKSGSLESGFAPFSNGTCPNSVILTPGPQ
FDPAYDQLRPQRLTEIWGNGNEETSKVFPLKSKQDYSFCLFSPFVYYKCDLEVTLSPHTSGNHGLLVRWCPTGTPTKPTTQVLHEVSSLSEGRTPQVYSA
GPGISNQISFVVPYNSPLSVLSAVWYNGHKRFDNTGSLGIAPNSDFGTLFFAGTKPDIKFTVYLRYKNKRVFCPRPTVFFPWPTSGDKIDMTPRAGVLML
ESPNALDISRTYPTLHVLIQFNHRGLEVRLFRHGHFWAETRADVILRSKTKQVSFLSNGNYPSMDSRAPWNPWKNTYQAVLRAEPCRVTMDIYYKRVRPF
RLPLVQKEWPVREENVFGLYRIFNAHYAGYFADLLIHDIETNPGPFMFRPRKQVFQTQGAAVSSMAQTLLPNDLASKAMGSAFTALLDANEDAQKAMKII
KTLSSLSDAWENVKETLNNPEFWKQLLSRCVQLIAGMTIAVMHPDPLTLLCLGTLTAAEITSQTSLCEEIAAKFKTIFITPPPRFPTISLFQQQSPLKQV
NDIFSLAKNLDWAVKTVEKVVDWFGTWIVQEEKEQTLDQLLQRFPEHAKRISDLRNGMAAYVECKESFDFFEKLYNQAVKEKRTGIAAVCEKFRQKHDHA
TARCEPVVIVLRGDAGQGKSLSSQVIAQAVSKTIFGRQSVYSLPPDSDFFDGYENQFAAIMDDLGQNPDGSDFTTFCQMVSTTNFLPNMASLERKGTPFT
SQLVVATTNLPEFRPVTIAHYPAVERRITFDYSVSAGPVCSKTEAGYKVLDVERAFRPTGEAPLPCFQNNCLFLEKAGLQFRDNRTKEIISLVDVIERAV
ARIERKKKVLTTVQTLVAQGPVDEVSFHSVVQQLKARQQATDEQLEELQEAFAKVQERNSVFSDWLKISAMLCAATLALSQVVKMAKAVKQMVKPDLVRV
QLDEQEQGPYNETARVKPKTLQLLDIQGPNPVMDFEKYVAKHVTAPIGFVYPTGVSTQTCLLVRGRTLVVNRHMAESDWTSIVVRGVTHARSTVKILAIA
KAGKETDVSFIRLSSGPLFRDNTSKFVKAGDVLPTGAAPVTGIMNTDIPMMYTGTFLKAGVSVPVETGQTFNHCIHYKANTRKGWCGSALLADLGGSKKI
LGIHSAGSMGIAAASIVSQEMIRAVVNAFEPQGALERLPDGPRIHVPRKTALRPTVARQVFQPAYAPAVLSKFDPRTEADVDEVAFSKHTSNQESLPPVF
RMVAKEYANRVFTLLGKDNGRLTVKQALEGLEGMDPMDRNTSPGLPYTALGMRRTDVVDWESATLIPFAAERLRKMNEGDFSEVVYQTFLKDELRPIEKV
QAAKTRIVDVPPFEHCILGRQLLGKFASKFQTQPGLELGSAIGCDPDVHWTAFGVAMQGFERVYDVDYSNFDSTHSVAMFRLLAEEFFTPENGFDPLTRE
YLESLAISTHAFEEKRFLITGGLPSGCAATSMLNTIMNNIIIRAGLYLTYKNFEFDDVKVLSYGDDLLVATNYQLDFDKVRASLAKTGYKITPANTTSTF
PLNSTLEDVVFLKRKFKKEGPLYRPVMNREALEAMLSYYRPGTLSEKLTSITMLAVHSGKQEYDRLFAPFREVGVVVPSFESVEYRWRSLFW
DLSANAAGSDPPRTYGQFSNLFSGAVNAFSNMLPLLADQNTEEMENLSDRVSQDTAGNTVTNTQSTVGRLVGYGTVHDGEHPASCADTASEKILAVERYY
TFKVNDWTSTQKPFEYIRIPLPHVLSGEDGGVFGAALRRHYLVKTGWRVQVQCNASQFHAGGLLVFMAPEYPTLDAFAMDNRWSKDNLPNGTRTQTNKKG
PFAMDHQNFWQWTLYPHQFLNLRTNTTVDLEVPYVNIAPTSSWTQHASWTLVIAVVAPLTYSTGASTSLDITASIQPVRPVFNGLRHETLSRQSPIPVTI
REHAGTWYSTLPDSTVPIYGKTPVAPSNYMVGEYKDFLEIAQIPTFIGNKIPNAVPYIEASNTAVKTQPLATYQVTLSCSCLANTFLAALSRNFAQYRGS
LVYTFVFTGTAMMKGKFLIAYTPPGAGKPTSRDQAMQATYAIWDLGLNSSYSFTVPFISPTHFRMVGTDQVNITNADGWVTVWQLTPLTYPPGCPTSAKI
LTMVSAGKDFSLKMPISPAPWSPQGVENAEKGVTENTNATADFVAQPVYLPENQTKVAFFYNRSSPIGAFTVKSGSLESGFAPFSNGTCPNSVILTPGPQ
FDPAYDQLRPQRLTEIWGNGNEETSKVFPLKSKQDYSFCLFSPFVYYKCDLEVTLSPHTSGNHGLLVRWCPTGTPTKPTTQVLHEVSSLSEGRTPQVYSA
GPGISNQISFVVPYNSPLSVLSAVWYNGHKRFDNTGSLGIAPNSDFGTLFFAGTKPDIKFTVYLRYKNKRVFCPRPTVFFPWPTSGDKIDMTPRAGVLML
ESPNALDISRTYPTLHVLIQFNHRGLEVRLFRHGHFWAETRADVILRSKTKQVSFLSNGNYPSMDSRAPWNPWKNTYQAVLRAEPCRVTMDIYYKRVRPF
RLPLVQKEWPVREENVFGLYRIFNAHYAGYFADLLIHDIETNPGPFMFRPRKQVFQTQGAAVSSMAQTLLPNDLASKAMGSAFTALLDANEDAQKAMKII
KTLSSLSDAWENVKETLNNPEFWKQLLSRCVQLIAGMTIAVMHPDPLTLLCLGTLTAAEITSQTSLCEEIAAKFKTIFITPPPRFPTISLFQQQSPLKQV
NDIFSLAKNLDWAVKTVEKVVDWFGTWIVQEEKEQTLDQLLQRFPEHAKRISDLRNGMAAYVECKESFDFFEKLYNQAVKEKRTGIAAVCEKFRQKHDHA
TARCEPVVIVLRGDAGQGKSLSSQVIAQAVSKTIFGRQSVYSLPPDSDFFDGYENQFAAIMDDLGQNPDGSDFTTFCQMVSTTNFLPNMASLERKGTPFT
SQLVVATTNLPEFRPVTIAHYPAVERRITFDYSVSAGPVCSKTEAGYKVLDVERAFRPTGEAPLPCFQNNCLFLEKAGLQFRDNRTKEIISLVDVIERAV
ARIERKKKVLTTVQTLVAQGPVDEVSFHSVVQQLKARQQATDEQLEELQEAFAKVQERNSVFSDWLKISAMLCAATLALSQVVKMAKAVKQMVKPDLVRV
QLDEQEQGPYNETARVKPKTLQLLDIQGPNPVMDFEKYVAKHVTAPIGFVYPTGVSTQTCLLVRGRTLVVNRHMAESDWTSIVVRGVTHARSTVKILAIA
KAGKETDVSFIRLSSGPLFRDNTSKFVKAGDVLPTGAAPVTGIMNTDIPMMYTGTFLKAGVSVPVETGQTFNHCIHYKANTRKGWCGSALLADLGGSKKI
LGIHSAGSMGIAAASIVSQEMIRAVVNAFEPQGALERLPDGPRIHVPRKTALRPTVARQVFQPAYAPAVLSKFDPRTEADVDEVAFSKHTSNQESLPPVF
RMVAKEYANRVFTLLGKDNGRLTVKQALEGLEGMDPMDRNTSPGLPYTALGMRRTDVVDWESATLIPFAAERLRKMNEGDFSEVVYQTFLKDELRPIEKV
QAAKTRIVDVPPFEHCILGRQLLGKFASKFQTQPGLELGSAIGCDPDVHWTAFGVAMQGFERVYDVDYSNFDSTHSVAMFRLLAEEFFTPENGFDPLTRE
YLESLAISTHAFEEKRFLITGGLPSGCAATSMLNTIMNNIIIRAGLYLTYKNFEFDDVKVLSYGDDLLVATNYQLDFDKVRASLAKTGYKITPANTTSTF
PLNSTLEDVVFLKRKFKKEGPLYRPVMNREALEAMLSYYRPGTLSEKLTSITMLAVHSGKQEYDRLFAPFREVGVVVPSFESVEYRWRSLFW
2292
Not Available
Not Available
01-11-1996
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
♦Leadear protein: promotes host NUP62, NUP153, and NUP214 phosphorylation and induces cessation of active nucleocytoplasmic transport. Proteins with NLS signals fail to import, cellular mRNAs fail to export, and some proteins small enough for diffusion are not retained anymore. The resulting inhibition of cellular protein synthesis serves to ensure maximal viral gene expression and to evade host immune response.
♦ Capsid proteins VP1, VP2, VP3 and VP4 form a closed capsid enclosing the viral positive strand RNA genome. VP4 lies on the inner surface of the protein shell formed by VP1, VP2 and VP3. All the three latter proteins contain a beta-sheet structure called beta-barrel jelly roll. Together they form an icosahedral capsid (T=3) composed of 60 copies of each VP1, VP2, and VP3, with a diameter of approxIMately 300 Angstroms. VP1 is situated at the 12 fivefold axes, whereas VP2 and VP3 are located at the quasi-sixfold axes (By similarity). The capsid interacts with host VCAM1 to provide virion attachment on murine vascular endothelial cells.
♦ Protein VP0: Protein VP0: VP0 precursor is a component of immature procapsids.
♦ Protein 2A: involved in host translation shutoff. Nuclear localization is required for this function.
♦ Protein 2B: affects membrane integrity and cause an increase in membrane permeability.
♦ Protein 2C: associates with and induces structural rearrangements of intracellular membranes. It displays RNA-binding, nucleotide binding and NTPase activities (By similarity).
♦ Protein 3A: via its hydrophobic domain, serves as membrane anchor.
♦ Protease 3C: cysteine protease that generates mature viral proteins from the precursor polyprotein. In addition to its proteolytic activity, it binds to viral RNA, and thus influences viral genome replication. RNA and substrate bind cooperatively to the protease (By similarity).
♦ RNA-directed RNA polymerase 3D-POL: replicates genomic and antigenomic RNA by recognizing replications specific signals.
♦ Capsid proteins VP1, VP2, VP3 and VP4 form a closed capsid enclosing the viral positive strand RNA genome. VP4 lies on the inner surface of the protein shell formed by VP1, VP2 and VP3. All the three latter proteins contain a beta-sheet structure called beta-barrel jelly roll. Together they form an icosahedral capsid (T=3) composed of 60 copies of each VP1, VP2, and VP3, with a diameter of approxIMately 300 Angstroms. VP1 is situated at the 12 fivefold axes, whereas VP2 and VP3 are located at the quasi-sixfold axes (By similarity). The capsid interacts with host VCAM1 to provide virion attachment on murine vascular endothelial cells.
♦ Protein VP0: Protein VP0: VP0 precursor is a component of immature procapsids.
♦ Protein 2A: involved in host translation shutoff. Nuclear localization is required for this function.
♦ Protein 2B: affects membrane integrity and cause an increase in membrane permeability.
♦ Protein 2C: associates with and induces structural rearrangements of intracellular membranes. It displays RNA-binding, nucleotide binding and NTPase activities (By similarity).
♦ Protein 3A: via its hydrophobic domain, serves as membrane anchor.
♦ Protease 3C: cysteine protease that generates mature viral proteins from the precursor polyprotein. In addition to its proteolytic activity, it binds to viral RNA, and thus influences viral genome replication. RNA and substrate bind cooperatively to the protease (By similarity).
♦ RNA-directed RNA polymerase 3D-POL: replicates genomic and antigenomic RNA by recognizing replications specific signals.
3.6.1.15 , 3.4.22.28 , 2.7.7.48
GO:0003723 ; GO:0003724 ; GO:0003968 ; GO:0004197 ; GO:0005198 ;
GO:0005216 ; GO:0005524 ; GO:0006351 ; GO:0016020 ; GO:0018144 ;
GO:0019030 ; GO:0019062 ; GO:0039520 ; GO:0039522 ; GO:0039540 ;
GO:0039657 ; GO:0039694 ; GO:0039707 ; GO:0042025 ; GO:0044162 ;
GO:0044385 ; GO:0046718 ; GO:0046872 ; GO:0051259
GO:0005216 ; GO:0005524 ; GO:0006351 ; GO:0016020 ; GO:0018144 ;
GO:0019030 ; GO:0019062 ; GO:0039520 ; GO:0039522 ; GO:0039540 ;
GO:0039657 ; GO:0039694 ; GO:0039707 ; GO:0042025 ; GO:0044162 ;
GO:0044385 ; GO:0046718 ; GO:0046872 ; GO:0051259
♦ Protein VP2: Virion. Host cytoplasm .
♦ Protein VP3: Virion. Host cytoplasm .
♦ Protein VP1: Virion. Host cytoplasm .
♦ Protein 2A: Host nucleus.
♦ Protein 2B: Host cytoplasmic vesicle membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication. These vesicles are derived from the endoplasmic reticulum (By similarity). .
♦ Protein 2C: Host cytoplasmic vesicle membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication. These vesicles are derived from the endoplasmic reticulum (By similarity). .
♦ Protein 3A: Host cytoplasmic vesicle membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication. These vesicles are derived from the endoplasmic reticulum (By similarity). .
♦ Protein 3B: Virion .
♦ Protease 3C: Host cytoplasm .
♦ RNA-directed RNA polymerase 3D-POL: Host cytoplasmic vesicle membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication. These vesicles are derived from the endoplasmic reticulum (By similarity). .
♦ Protein VP3: Virion. Host cytoplasm .
♦ Protein VP1: Virion. Host cytoplasm .
♦ Protein 2A: Host nucleus.
♦ Protein 2B: Host cytoplasmic vesicle membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication. These vesicles are derived from the endoplasmic reticulum (By similarity). .
♦ Protein 2C: Host cytoplasmic vesicle membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication. These vesicles are derived from the endoplasmic reticulum (By similarity). .
♦ Protein 3A: Host cytoplasmic vesicle membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication. These vesicles are derived from the endoplasmic reticulum (By similarity). .
♦ Protein 3B: Virion .
♦ Protease 3C: Host cytoplasm .
♦ RNA-directed RNA polymerase 3D-POL: Host cytoplasmic vesicle membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication. These vesicles are derived from the endoplasmic reticulum (By similarity). .
♦DOMAIN 1281 1447 SF3 helicase.
♦ DOMAIN 2061 2179 RdRp catalytic.
♦ DOMAIN 2061 2179 RdRp catalytic.
Not Available
Predicted/Modelled
Not Available
♦ACT_SITE 1673 1673 For protease 3C activity.
♦ ACT_SITE 1705 1705 For protease 3C activity.
♦ ACT_SITE 1786 1786 For protease 3C activity.
♦ ACT_SITE 1705 1705 For protease 3C activity.
♦ ACT_SITE 1786 1786 For protease 3C activity.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available