viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Mammalia [TaxID: 40674]
N[Gene ID: 14857942 ]
Nucleoprotein (NP) (Nucleocapsid protein) (Protein N)
Duvenhage Virus (DUVV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Rhabdoviridae> Lyssavirus> Duvenhage Virus (DUVV)
Various pathway(s) in which protein is involved
Not Available
MDAERIVFKVRNQLVSVKPEVISDQYEYKYPAITDKKKPSITLGRAPDLKTAYKSILSGMNAAKLDPDDVCSYLAGAMILFEGVCPEDWVSYGIHIARKG
DKITPATLVDIVRTNTEGNWAQTGGQDLTRDPTISEHASLVGLLLCLYRLSKIVGQNTGNYKTNVADRMEQIFETAPFVKIVEHHTLMTTHKMCANWSTI
PNFRFLAGTYDMFFSRVDHLYSAIRVGTVVTAYEDCSGLVSFTGFIKQINLTAREAILYFFHKNFEEEIKRMFEPGQETAVPHSYFIHFRSLGLSGKSPY
SSNAVGHVFNLIHFVGCYMGQIRSLNATVIQSCAPHEMSVLGGYLGEEFFGKGTFERRFFRDEKELQDYEEAEATKIEAALADDGTVNSDDEDFFSGDTR
SPEAVYTRIMMNGGRLKGAHIRRYVSVSSSHQARPNSFAEFLNKTYSSDSR
451
Not Available
Not Available
01-11-1996
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Encapsidates the genome, protecting it from nucleases. If expressed without protein P it binds non-specifically RNA and therefore can bind it's own mRNA. Interaction with protein P abolishes any non-specific RNA binding, and prevents phosphorylation. The soluble N-P complex encapsidates specifically the genomic RNA, with protein N protecting the genome like a pearl necklace. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for viral transcription and replication. Protein N binds protein P in the NC through a different interaction, and can be phosphorylated. Subsequent viral replication is dependent on intracellular concentration of newly synthesized protein N. During replication, encapsidation by protein N is coupled to RNA synthesis and all replicative products are resistant to nucleases (By similarity).
Not Available
GO:0003723  ;   GO:0019013  ;   GO:0019029  ;   GO:0030430  
Virion. Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available