viHumans
Reviewed
Epomops Franqueti (Franquet's Epauleted Fruit Bat) [TaxID: 77231]; Homo Sapiens (Human) [TaxID: 9606]; Myonycteris Torquata (Little Collared Fruit Bat) [TaxID: 77243]
VP30[Gene ID: 3160773 ]
Minor nucleoprotein VP30 (Transcription activator VP30)
Sudan Ebolavirus (strain Human/Uganda/Gulu/2000) (SEBOV) (Sudan Ebola Virus)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Filoviridae> Ebolavirus> Sudan Ebolavirus> Sudan Ebolavirus (strain Human/Uganda/Gulu/2000) (SEBOV) (Sudan Ebola Virus)
Not Available
Various pathway(s) in which protein is involved
Not Available
MERGRERGRSRNSRADQQNSTGPQFRTRSISRDKTTTDYRSSRSTSQVRVPTVFHKKGTGTLTVPPAPKDVCPTLRKGFLCDSNFCKKDHQLESLTDREL
LLLIARKTCGSTDSSLNIAAPKDLRLANPTADDFKQDGSPKLTLKLLVETAEFWANQNINEVDDAKLRALLTLSAVLVRKFSKSQLSQLCESHLRRENLG
QDQAESVLEVYQRLHSDKGGAFEAALWQQWDRQSLTMFISAFLHVALQLSCESSTVVISGLRLLAPPSVNEGLPPAPGEYTWSEDSTT
288
Not Available
Not Available
23-11-2004
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Acts as a transcription anti-termination factor immediately after transcription initiation, but does not affect transcription elongation. This function has been found to be dependent on the formation of an RNA stem-loop at the transcription start site of the first gene. Binds to RNA (By similarity).
Not Available
GO:0003723  ;   GO:0006351  ;   GO:0019013  ;   GO:0030430  ;   GO:0046872  
Virion. Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available