Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L3
Protease (EC 3.4.22.39) (Adenain) (Adenovirus protease) (AVP) (Adenovirus proteinase) (Endoprotease)
Human Adenovirus D Serotype 9 (HAdV-9) (Human Adenovirus 9)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus D> Human Adenovirus D Serotype 9 (HAdV-9) (Human Adenovirus 9)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSGSSERELAAIVRDLGCGPYFLGTHDKRFPGFLAGDKLACAIVNTAGRETGGVHWLAFGWNPRSRTCYMFDPFGFSDRRLKQIYSFEYEAMLRRSALAS
SPDRCLSLEQSTQTVQGPDSAACGLFCCMFLHAFVHWPDRPMDGNPTMNLLTGVPNGMLQSPQVLPTLRRNQEELYRFLARHSPYFRSHRAAIEHATAFD
KMKQLRVSQ
SPDRCLSLEQSTQTVQGPDSAACGLFCCMFLHAFVHWPDRPMDGNPTMNLLTGVPNGMLQSPQVLPTLRRNQEELYRFLARHSPYFRSHRAAIEHATAFD
KMKQLRVSQ
209
Not Available
Not Available
21-12-2004
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Cleaves viral precursor proteins (pTP, pIIIa, pVI, pVII, pVIII, and pX) inside newly assembled particles giving rise to mature virions. Protease complexed to its cofactor slides along the viral DNA to specifically locate and cleave the viral precursors. Mature virions have a weakened organization compared to the unmature virions, thereby facilitating subsequent uncoating. Without maturation, the particle lacks infectivity and is unable to uncoat. Late in adenovirus infection, in the cytoplasm, may participate in the cytoskeleton destruction. Cleaves host cell cytoskeletal keratins K7 and K18.
3.4.22.39
Virion . Host nucleus . Note=Present in about 10 copies per virion. .
Not Available
Not Available
Predicted/Modelled
Not Available
♦ACT_SITE 55 55
♦ ACT_SITE 72 72
♦ ACT_SITE 123 123
♦ ACT_SITE 72 72
♦ ACT_SITE 123 123
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available