Reviewed
Homo Sapiens (Human) [TaxID: 9606]
E sM 5[Gene ID: 3200430 ]
Envelope small membrane protein (E protein) (sM protein)
Human Coronavirus HKU1 (isolate N1) (HCoV-HKU1)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Nidovirales> Coronaviridae> Coronavirinae> Betacoronavirus> Human Coronavirus HKU1 (HCoV-HKU1)> Human Coronavirus HKU1 (isolate N1) (HCoV-HKU1)
Various pathway(s) in which protein is involved
Not Available
MVDLFFNDTAWYIGQILVLVLFCLISLIFVVAFLATIKLCMQLCGFCNFFIISPSAYVYKRGMQLYKSYSEQVIPPTSDYLI
82
Not Available
Not Available
01-02-2005
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a central role in virus morphogenesis and assembly. Acts as a viroporin and self-assembles in host membranes forming pentameric protein-lipid pores that allow ion transport. Also plays a role in the induction of apoptosis.
Not Available
♦ Host Golgi apparatus membrane
♦ Single-pass type III membrane protein . Note=The cytoplasmic tail functions as a Golgi complex-targeting signal. .
♦ Single-pass type III membrane protein . Note=The cytoplasmic tail functions as a Golgi complex-targeting signal. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available