viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
N I 7b[Gene ID: 3200424 ]
Protein I (Accessory protein N2) (N internal ORF protein) (IORF) (Orf8 protein) (Protein in nucleocapsid ORF)
Human Coronavirus HKU1 (isolate N1) (HCoV-HKU1)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Nidovirales> Coronaviridae> Coronavirinae> Betacoronavirus> Human Coronavirus HKU1 (HCoV-HKU1)> Human Coronavirus HKU1 (isolate N1) (HCoV-HKU1)
Various pathway(s) in which protein is involved
Not Available
MLEVEAPLEIVQESSRKLLGLTNLSEITKPLIEAEKPNLNSLCLLNHKEILSHIIPGSPGSLNFKKVETLNFQMVKEFPLLSEYPLLKQKDIGIDTAGVL
LKQLMVNKSSCYRDGISTISVPAHMPMHPMVNPSKGSSGLLITKLTLLLPPMFRQGILLLKKLSLLGFRLVRFCLKAIMLKAQEGLLLIVDQVHVLNHVD
PIIVH
205
Not Available
Not Available
01-02-2005
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Structural protein that is not essential for the viral replication either in tissue culture or in its natural host.
Not Available
Virion .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available