viHumans
Reviewed
Gerbillinae (gerbils) [TaxID: 10045]; Homo Sapiens (Human) [TaxID: 9606]; Phlebotomus Papatasi (Sandfly) [TaxID: 29031]
N[Gene ID: 14857918 ]
Nucleoprotein (NP) (Nucleocapsid protein) (Protein N)
Isfahan Virus (ISFV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Rhabdoviridae> Vesiculovirus> Isfahan Vesiculovirus> Isfahan Virus (ISFV)
Not Available
Various pathway(s) in which protein is involved
Not Available
MTSVVKRIATGSSVLAVLPANEDPVEFPGDYFLQNPGKIRVCINRKLDVATLRQYVYEGLKNGDVHVCHINSYLYQVLKDTRDEAQSDWISFGVSLAVKG
GIVSVFDTLMIEDYRGEAPDGRKCDGRTIDDDKWLPMLILGLYRVSRATQEDYKKSLLQKLYAQCKLRSPQAEELVEDAAEFYEVWSNDSNFLKLVAAID
MFFHKFKNHADAGLRWGTIVSRFKDCAALATLSHVQKVTGLSIKEVFTWVLNKSVEDELCRMMKERQEVDKADSYMPYLIDFGISTKSPYSSVKNPCFHF
WGQLTALLVHSHRAKNARVPEDIPYNELTTAAWLFAYAMGRSSGLEQRFTTDDSYYQEDEDINKGLGVKAPTTRDVQMWLAWWSDIGKVPTQDMETFARR
EVLGLTEIRSKTIGEYAKKTFSV
423
Not Available
Not Available
15-02-2005
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Encapsidates the genome in a ratio of one N per nine ribonucleotides, protecting it from nucleases. The encapsidated genomic RNA is termed the NC and serves as template for transcription and replication. Replication is dependent on intracellular concentration of newly synthesized N, termed N(0), which corresponds to the protein not associated with RNA. In contrast, when associated with RNA, it is termed N. During replication, encapsidation by N(0) is coupled to RNA synthesis and all replicative products are resistant to nucleases (By similarity).
Not Available
GO:0003723  ;   GO:0019013  ;   GO:0019029  ;   GO:0030430  
Virion. Host cytoplasm. Note=The nucleocapsid is synthesized in the cytoplasm, and is subsequently transported via microtubules to the cell periphery. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available