Reviewed
Gerbillinae (gerbils) [TaxID: 10045]; Homo Sapiens (Human) [TaxID: 9606]; Phlebotomus Papatasi (Sandfly) [TaxID: 29031]
P[Gene ID: 14857916 ]
Phosphoprotein (Protein P) (Protein M1)
Isfahan Virus (ISFV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Rhabdoviridae> Vesiculovirus> Isfahan Vesiculovirus> Isfahan Virus (ISFV)
Not Available
Various pathway(s) in which protein is involved
Not Available
MSRLNQILKDYPLLEATTSEIESMESSLADDVITSNDDEIQSVSPQYYLRDMFKASITEGPDDDFPPVPEVENDIILDDDEEYDGYKVDFAEARPWTALT
QKNIDGRMNLELMAPENLTDAQYKQWVESVSSIMTISRQIRLHQAEIMDTSSGLLIIENMIPSIGRTSEFKSIPEHIPPSPTSDHTTPPSSLRSDTPSQT
SSSSMGLPDVSSASDWSGMINKKIRIPPVVSSKSPYEFTLSDLYGSNQAALDYLSGSGMDLRTAVCSGLKQRGIYNRIRIQYKITPEFV
QKNIDGRMNLELMAPENLTDAQYKQWVESVSSIMTISRQIRLHQAEIMDTSSGLLIIENMIPSIGRTSEFKSIPEHIPPSPTSDHTTPPSSLRSDTPSQT
SSSSMGLPDVSSASDWSGMINKKIRIPPVVSSKSPYEFTLSDLYGSNQAALDYLSGSGMDLRTAVCSGLKQRGIYNRIRIQYKITPEFV
289
Not Available
Not Available
15-02-2005
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Essential component of the RNA polymerase transcription and replication complex. Binds the viral ribonucleocapsid and positions the L polymerase on the template. May act as a chaperone for newly synthesized free N protein, so-called N(0). Plays a role in virion assembly (By similarity).
Not Available
Virion. Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available