viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF3[Gene ID: 1487681 ]
Tegument protein UL55 homolog
Varicella-zoster Virus (strain Oka Vaccine) (HHV-3) (Human Herpesvirus 3)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Varicellovirus> Human Herpesvirus 3 (HHV-3) (Varicella-zoster Virus)> Varicella-zoster Virus (strain Oka Vaccine) (HHV-3) (Human Herpesvirus 3)
Various pathway(s) in which protein is involved
Not Available
MDTTGASESSQPIRVNLKPDPLASFTQVIPPLALETTWTCPANSHAPTPSPLYGVKRLCALRATCGRADDLHAFLIGLGRRDKPSESPMYVDLQPFCSLL
NSQRLLPEMANYNTLCDAPFSAATQQMMLESGQLGVHLAAIGYHCHCKSPFSAECWTGASEAYDHVVCGGKARAAVGGL
179
Not Available
Not Available
24-03-2009
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Not Available
Not Available
Virion tegument . Host nucleus matrix .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available