viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF4[Gene ID: 1487672 ]
mRNA export factor ICP27 homolog (Immediate-early protein 4) (IE4)
Varicella-zoster Virus (strain Oka Vaccine) (HHV-3) (Human Herpesvirus 3)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Varicellovirus> Human Herpesvirus 3 (HHV-3) (Varicella-zoster Virus)> Varicella-zoster Virus (strain Oka Vaccine) (HHV-3) (Human Herpesvirus 3)
Various pathway(s) in which protein is involved
Not Available
MASASIPTDPDVSTICEDFMNLLPDEPSDDFALEVTDWANDEAIGSTPGEDSTTSRTVYVERTADTAYNPRYSKRRHGRRESYHHNRPKTLVVVLPDSNH
HGGRDVETGYARIERGHRRSSRSYNTQSSRKHRDRSLSNRRRRPTTPPAMTTGERNDQTHDESYRLRFSKRDARRERIRKEYDIPVDRITGRAIEVVSTA
GASVTIDSVRHLDETIEKLVVRYATIQEGDSWASGGCFPGIKQNTSWPELMLYGHELYRTFESYKMDSRIARALRERVIRGESLIEALESADELLTWIKM
LAAKNLPIYTNNPIVATSKSLLENLKLKLGPFVRCLLLNRDNDLGSRTLPELLRQQRFSDITCITTYMFVMIARIANIVVRGSKFVEYDDISCNVQVLQE
YTPGSCLAGVLEALITHQRECGRVECTLSTWAGHLSDARPYGKYFKCSTFNC
452
Not Available
Not Available
24-03-2009
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Multifunctional regulator of the expression of viral genes that mediates nuclear export of viral intronless mRNAs. This immediate early (EI) protein promotes the nuclear export of viral intronless mRNAs by interacting with mRNAs and host NXF1/TAP (By similarity).
Not Available
GO:0003723  ;   GO:0006351  ;   GO:0006355  ;   GO:0016032  ;   GO:0030430  ;  
GO:0042025  ;   GO:0046872  
Host cytoplasm . Host nucleus . Note=Shuttles between the nucleus and the cytoplasm. IE4 utilizes, at least, XPO1/CRM1 as a cofactor for nuclear export (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available