Reviewed
Homo Sapiens (Human) [TaxID: 9606]
GK ORF5[Gene ID: 1487673 ]
Envelope glycoprotein K (Syncytial protein)
Varicella-zoster Virus (strain Oka Vaccine) (HHV-3) (Human Herpesvirus 3)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Varicellovirus> Human Herpesvirus 3 (HHV-3) (Varicella-zoster Virus)> Varicella-zoster Virus (strain Oka Vaccine) (HHV-3) (Human Herpesvirus 3)
Various pathway(s) in which protein is involved
Not Available
MQALGIKTEHFIIMCLLSGHAVFTLWYTARVKFEHECVYATTVINGGPVVWGSYNNSLIYVTFVNHSTFLDGLSGYDYSCRENLLSGDTMVKTAISTPLH
DKIRIVLGTRNCHAYFWCVQLKMIFFAWFVYGMYLQFRRIRRMFGPFRSSCELISPTSYSLNYVTRVISNILLGYPYTKLARLLCDVSMRRDGMSKVFNA
DPISFLYMHKGVTLLMLLEVIAHISSGCIVLLTLGVAYTPCALLYPTYIRILAWVVVCTLAIVELISYVRPKPTKDNHLNHINTGGIRGICTTCCATVMS
GLAIKCFYIVIFAIAVVIFMHYEQRVQVSLFGESENSQKH
DKIRIVLGTRNCHAYFWCVQLKMIFFAWFVYGMYLQFRRIRRMFGPFRSSCELISPTSYSLNYVTRVISNILLGYPYTKLARLLCDVSMRRDGMSKVFNA
DPISFLYMHKGVTLLMLLEVIAHISSGCIVLLTLGVAYTPCALLYPTYIRILAWVVVCTLAIVELISYVRPKPTKDNHLNHINTGGIRGICTTCCATVMS
GLAIKCFYIVIFAIAVVIFMHYEQRVQVSLFGESENSQKH
340
Not Available
Not Available
24-03-2009
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Glycoprotein that probably modulates membrane fusion events during secondary envelopment of cytoplasmic capsids that bud into specific trans-Golgi network (TGN)-derived membranes. Also plays a role, together with gB, in virus-induced cell-to-cell fusion (syncytia formation), which is extensive during VZV infection in cultured cells (By similarity).
Not Available
♦ Host cell membrane
♦ Multi-pass membrane protein . Host endosome membrane
♦ Multi-pass membrane protein . Host Golgi apparatus membrane
♦ Multi-pass membrane protein . Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported with UL20 to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN). Cell surface expression of gK is required for virus-induced cell-to-cell fusion. Likely not present in extracellular virions (By similarity). .
♦ Multi-pass membrane protein . Host endosome membrane
♦ Multi-pass membrane protein . Host Golgi apparatus membrane
♦ Multi-pass membrane protein . Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported with UL20 to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN). Cell surface expression of gK is required for virus-induced cell-to-cell fusion. Likely not present in extracellular virions (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available