viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF7[Gene ID: 1487677 ]
Tegument protein UL51 homolog (Protein ORF7)
Varicella-zoster Virus (strain Oka Vaccine) (HHV-3) (Human Herpesvirus 3)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Varicellovirus> Human Herpesvirus 3 (HHV-3) (Varicella-zoster Virus)> Varicella-zoster Virus (strain Oka Vaccine) (HHV-3) (Human Herpesvirus 3)
Various pathway(s) in which protein is involved
Not Available
MQTVCASLCGYARIPTEEPSYEEVRVNTHPQGAALLRLQEALTAVNGLLPAPLTLEDVVASADNTRRLVRAQALARTYAACSRNIECLKQHHFTEDNPGL
NAVVRSHMENSKRLADMCLAAITHLYLSVGAVDVTTDDIVDQTLRMTAESEVVMSDVVLLEKTLGVVAKPQASFDVSHNHELSIAKGENVGLKTSPIKSE
ATQLSEIKPPLIEVSDNNTSNLTKKTYPTETLQPVLTPKQTQDVQRTTPAIKKSHVMLV
259
Not Available
Not Available
24-03-2009
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays several roles during the time course of infection, including egress of virus particles from the perinuclear space and secondary envelopment of cytoplasmic capsids that bud into specific trans-Golgi network (TGN)-derived membranes (PubMed:28356523). Localizes its binding partner ORF53 to the host trans-Golgi network (TGN) (PubMed:29116592).
Not Available
Virion . Virion tegument . Host cytoplasm . Host Golgi apparatus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available