viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF9
Tegument protein VP22 (ORF9 protein) (Tegument protein 9)
Varicella-zoster Virus (strain Oka Vaccine) (HHV-3) (Human Herpesvirus 3)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Varicellovirus> Human Herpesvirus 3 (HHV-3) (Varicella-zoster Virus)> Varicella-zoster Virus (strain Oka Vaccine) (HHV-3) (Human Herpesvirus 3)
Various pathway(s) in which protein is involved
Not Available
Not Available
MASSDGDRLCRSNAVRRKTTPSYSGQYRTARRSVVVGPPDDSDDSLGYITTVGADSPSPVYADLYFEHKNTTPRVHQPNDSSGSEDDFEDIDEVVAAFRE
ARLRHELVEDAVYENPLSVEKPSRSFTKNAAVKPKLEDSPKRAPPGAGAIASGRPISFSTAPKTATSSWCGPTPSYNKRVFCEAVRRVAAMQAQKAAEAA
WNSNPPRNNAELDRLLTGAVIRITVHEGLNLIQAANEADLGEGASVSKRGHNRKTGDLQGGMGNEPMYAQVRKPKSRTDTQTTGRITNRSRARSASRTDA
RK
302
Not Available
Not Available
02-08-2005
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Tegument protein that plays different roles during the time course of infection. Participates in both the accumulation of viral mRNAs and viral protein translation at late time of infection. Modulates the RNase activity of the virion host shutoff protein ORF17 probably to ensure necessary levels of key cellular mRNAs and proteins. Plays a role in microtubule reorganization that occurs after viral infection by stabilizing microtubule network.
Not Available
Virion tegument . Host cytoplasm . Host nucleus . Host Golgi apparatus . Note=One of the most abundant tegument protein (about 2000 copies per virion). Localizes in the cytoplasm at 8 hours postinfection and in the nucleus at 16 hours postinfection. During virion morphogenesis, this protein probably accumulates at the trans-Golgi where secondary envelopment occurs. .
Not Available
MOTIF 212 224 Nuclear export signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available