viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF10
Tegument protein VP16 homolog (Alpha trans-inducing protein) (Alpha-TIF) (ORF10 protein) (Tegument protein 10)
Varicella-zoster Virus (strain Oka Vaccine) (HHV-3) (Human Herpesvirus 3)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Varicellovirus> Human Herpesvirus 3 (HHV-3) (Varicella-zoster Virus)> Varicella-zoster Virus (strain Oka Vaccine) (HHV-3) (Human Herpesvirus 3)
Various pathway(s) in which protein is involved
Not Available
Not Available
MECNLGTEHHSTDTWNRSKTEQAVVDAFDESLFGDVASDIGSETSLYSHAVKTAPSPPWVASPKILYQQLIRDLDFSEGPRLLSCLETWNEDLFSCFPIN
EDLYSDMMVLSPDPDDVISTVSTKDHVEMFNLTTRGSVRLPSPPKQPTGLPAYVQEVQDSFTVELRAREEAYTKLLVTYCKSIIRYLQGTAKRTTIGLNI
QNPDQKAYTQLRQSILLRYYREVASLARLLYLHLYLTVTREFSWRLYASQSAHPDVFAALKFTWTERRQFTCAFHPVLCNHGIVLLEGKPLTASALREIN
YRRRELGLPLVRCGLVEENKSPLVQQPSFSVHLPRSVGFLTHHIKRKLDAYAVKHPQEPRHVRADHPYAKVVENRNYGSSIEAMILAPPSPSEILPGDPP
RPPTCGFLTR
410
Not Available
Not Available
02-08-2005
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
♦Transcriptional activator of immediate-early (IE) gene products (alpha genes). Acts as a key activator of lytic infection by initiating the lytic program through the assembly of the transcriptional regulatory VP16-induced complex composed of VP16 and two cellular factors, HCFC1 and POU2F 1. VP16-induced complex represents a regulatory switch: when it is on, it promotes IE-gene expression and thus lytic infection, and when it is off, it limits IE-gene transcription favoring latent infection (By similarity).
♦ May play a role in the aggregation of tegument proteins around nucleocapsids during virus morphogenesis.
Not Available
GO:0003677  ;   GO:0006351  ;   GO:0006355  ;   GO:0019033  ;   GO:0039695  ;  
GO:0042025  
Virion tegument . Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available