viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Inner capsid protein VP2
Rotavirus X (strain RVX/Human/China/NADRV-J19/1997/GXP[X]) (RV ADRV-N) (Rotavirus (isolate Novel Adult Diarrhea Rotavirus-J19))
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Rotavirus H> Rotavirus X (strain RVX/Human/China/NADRV-J19/1997/GXP[X]) (RV ADRV-N) (Rotavirus (isolate Novel Adult Diarrhea Rotavirus-J19))
Not Available
Various pathway(s) in which protein is involved
Not Available
MEVIEKLETIRETLNDTKDKKDFQKIHDELVQYLDGIDPLTIDDDKWNEILKLFKIIIVKLKNSTIKTTSLENELTQHEKKRTVKEVEKVEEDMKVDVAN
DNSKPTLMDKVLQVSSQPNNPYSADVLQIRTILSKTLFVDTDSEAYSLYVPESQKLDVSPITIELTTIEKYQPKVNILKQAVIVPSQNPLLADTYGAPEI
LFSTDFFDDITSNSSEGLQLYFFDKAYKLKKELPNLPFLSSLDKDVNPLNPLNSVCKSFGQEKYYDMVMDRTDRGLDARRAAMQFDNVIVDAQNRTVQFN
VRMHPFDLQLLRISQQFAEPMQDLAPVVREYMMLGADGYVLTQKTRLDRDQQLIANRRSVVFDRMCELSGPLYRSRIVHSMRMMSKLWRTNVFRTSLEDE
ITKIYAAAEVSMVSIDATTSALSTINIASAEQTLNALLNMSFFRCELDLIGSQSSFGAAMSAMIALMILPTDQENMDDEVFDVLCNLVYNELIAWAADRP
VFVRRAGATNAFRQFVNAGLNRDITNYMRFVLLRRPWLPLYNSRDVRRNAHVLVPNVDLANINDQVYVAINSFLNGIIEASRRNPNPNKTISANSFRKLM
KNMRDICVNRLMPVIRLIRYNVERIGMILHMLPYSADIFDINRNLRDERLRIKIPMSGFLSLVMGITKAPDAFDWSQVLNFADDVRKMDYAEAISIEDSA
SVAIMRNDANRATSKKEIFISEVKPPTPTVASIQKIPSATLTAMFSDRQLINLIRDTHSFRVIREIAVALQAAFDNSPTSQHGVGKGAVLHPVPQNFGRS
SQFVRRDNILLQRPAGIQQFTIEDLKQGRYFQGLMAQIRARQPIIVNGPIPLRISDAAEIEQVTLAFLTMNSPYDAYIDPRDLKQQKLLTDREVDLFIDQ
NPARPNDEFDNVMARTSVFIIDAPRAIVPINPQRLNFPYHDIMVTDSVTKFIEFTVALTPDLQLFNGLLVFEQ
973
Not Available
Not Available
13-09-2005
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Inner capsid protein that self-assembles to form an icosahedral capsid with a T=2 symmetry, which consists of 120 copies of VP2, with channels at each of its five-fold vertices. This capsid constitutes the innermost concentric layer of the viral mature particle. It encapsidates the polymerase VP1, the capping enzyme VP3 and the genomic dsRNA, thereby defining the core. The innermost VP2 capsid and the intermediate VP6 capsid remain intact following cell entry to protect the dsRNA from degradation and to prevent unfavorable antiviral responses in the host cell during all the replication cycle of the virus. Nascent transcripts are transcribed within the structural confines of this double-layered particle (DLP) and are extruded through the channels formed by VP2 N-termini. VP2 is required for the replicase activity of VP1 polymerase. Probably recruits a copy of a VP1-VP3 complex, potentially along with a segment of plus-strand RNA, as a decamer of VP2 assembles. May activate the autoinhibited VP1/RNA complex to coordinate packaging and genome replication.
Not Available
Virion . Note=Inner capsid protein. Also found in spherical cytoplasmic structures, called virus factories, that appear early after infection and are the site of viral replication and packaging. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available