Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Non-structural protein 2 (NSP2) (EC 3.6.4.-) (NCVP3) (Non-structural RNA-binding protein 35) (NS35)
Rotavirus X (strain RVX/Human/China/NADRV-J19/1997/GXP[X]) (RV ADRV-N) (Rotavirus (isolate Novel Adult Diarrhea Rotavirus-J19))
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Rotavirus H> Rotavirus X (strain RVX/Human/China/NADRV-J19/1997/GXP[X]) (RV ADRV-N) (Rotavirus (isolate Novel Adult Diarrhea Rotavirus-J19))
Not Available
Various pathway(s) in which protein is involved
Not Available
MVSIKVSLADFIVKTEEGWIPSDNCPALDRFKTKTEKELLDSIKKEGADRASIRKQLFLTSISNKRLTQLGGVPVRDIRTSTTIPSSTRNLITDWLLNIF
NDEESGEEVESAIASKYPDIFCSADKISRVAQRLENRRDRVHEDGFRILSATMLAIDSDIATEGKCEIVRATEDAIIAKFEPVSEHLCIGNPRGVFYKAF
PIKKEQPMVYGVKALLGISNRDFIMNHGHGHLRTVPYSEINNAVRSFAKKNEAEIKRIRSDSLSPNAGEKFINMCDMLLQKEKIETVIAKIMKSDKN
NDEESGEEVESAIASKYPDIFCSADKISRVAQRLENRRDRVHEDGFRILSATMLAIDSDIATEGKCEIVRATEDAIIAKFEPVSEHLCIGNPRGVFYKAF
PIKKEQPMVYGVKALLGISNRDFIMNHGHGHLRTVPYSEINNAVRSFAKKNEAEIKRIRSDSLSPNAGEKFINMCDMLLQKEKIETVIAKIMKSDKN
297
Not Available
Not Available
13-09-2005
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Participates in replication and packaging of the viral genome. Plays a crucial role, together with NSP5, in the formation of virus factories (viroplasms) which are large inclusions in the host cytoplasm where replication intermediates are assembled and viral RNA replication takes place. Displays ssRNA binding, NTPase, RNA triphosphatase (RTPase) and ATP-independent helix-unwinding activities. The unwinding activity may prepare and organize plus-strand RNAs for packaging and replication by removing interfering secondary structures. The RTPase activity plays a role in the removal of the gamma-phosphate from the rotavirus RNA minus strands of dsRNA genome segments.
3.6.4.-
Host cytoplasm . Note=Found in spherical cytoplasmic structures, called viral factories, that appear early after infection and are the site of viral replication and packaging. .
Not Available
Not Available
Predicted/Modelled
Not Available
ACT_SITE 231 231 For NTPase and RTPase activities.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available