viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Non-structural protein 3 (NSP3) (NCVP4) (Non-structural RNA-binding protein 34) (NS34)
Rotavirus A (isolate RVA/Human/Belgium/B4106/2000/G3P11[14]) (RV-A) (Rotavirus A (isolate B4106))
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Rotavirus A> Rotavirus G3> Rotavirus A (isolate RVA/Human/Belgium/B4106/2000/G3P11[14]) (RV-A) (Rotavirus A (isolate B4106))
Various pathway(s) in which protein is involved
Not Available
Not Available
MLKMESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNEVYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAVRNRNWMTDTRTTARLDED
VNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIIKCTRLMRDKIERGEVEVDDSFVEEKMEVDTIDWKSRYEQLEKRFESLKQRVNEKYTSWVQKAK
KVNENMYSLQNVISQQQSQIADLQHYCNKLEVDLQNKISSLVSSIEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFESLIRNVILDYDRTFLMFK
GLMRQCNYEYTYE
313
Not Available
Not Available
27-09-2005
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays an important role in stimulating the translation of viral mRNAs. These mRNAs are capped but not polyadenylated, instead terminating in a conserved sequence 'GACC' at the 3' that is recognized by NSP3, which competes with host PABPC1 for EIF4G1 binding. The interaction between NSP3 and host EIF4G1 stabilizes the EIF4E-EIF4G1 interaction, thereby facilitating the initiation of capped mRNA translation.
Not Available
GO:0003723  ;   GO:0006417  ;   GO:0016032  ;   GO:0030430  
Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available