Reviewed
Homo Sapiens (Human) [TaxID: 9606]
BZLF1
Trans-activator protein BZLF1 (EB1) (Zebra)
Epstein-Barr Virus (strain GD1) (HHV-4) (Human Herpesvirus 4)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Lymphocryptovirus> Epstein-Barr Virus (strain GD1) (HHV-4) (Human Herpesvirus 4)
Various pathway(s) in which protein is involved
Not Available
Not Available
MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQLTAYHVSAAPTGSWFPAPQPAPENAYQAYAAPQLFPVSDI
TQNQLTNQAGGEAPQPGDNSTVQPAAAVVLACPGANQEQQLADIGAPQPAPAAAPARRTRKPLQPESLEECDSELEIKRYKNRVASRKCRAKFKHLLQHY
REVASAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHEDLLNF
TQNQLTNQAGGEAPQPGDNSTVQPAAAVVLACPGANQEQQLADIGAPQPAPAAAPARRTRKPLQPESLEECDSELEIKRYKNRVASRKCRAKFKHLLQHY
REVASAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHEDLLNF
245
Not Available
Not Available
08-11-2005
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Plays a key role in the switch from latent infection to lytic cycle producing new virions. Acts as a transcription factor, inducing early lytic cycle genes, and as a origin binding protein for genome replication. BZLF1 activates the promoter of another EBV gene (BSLF2+BMLF1) (By similarity).
Not Available
Host nucleus .
DOMAIN 178 228 bZIP.
Not Available
X-ray crystallography (4)
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available