Reviewed
Aves [TaxID: 8782]; Cetacea (whales) [TaxID: 9721]; Homo Sapiens (Human) [TaxID: 9606]; Phocidae (true Seals) [TaxID: 9709]; Sus Scrofa (Pig) [TaxID: 9823]
NS
Non-structural protein 1 (NS1) (NS1A)
Influenza A Virus (strain A/Memphis/2/1978 H3N2)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Alphainfluenzavirus> Influenza A Virus> H3N2 Subtype> Influenza A Virus (strain A/Memphis/2/1978 H3N2)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MDSNTVSSFQVDCFLWHVRKQVVDQELGDAPFLDRLRRDQRSLRGRGSTLGLDIEAATHVGKQIVEKILKEESDEALKMSMASTPASRYITDMTIEELSR
DWFMLMPKQKVEGPLCIRMDQAIMEKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLLSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQR
FAWGSSNENGGPPLTPKQKRKMARTARSKVRRDKMAD
DWFMLMPKQKVEGPLCIRMDQAIMEKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLLSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQR
FAWGSSNENGGPPLTPKQKRKMARTARSKVRRDKMAD
237
Not Available
Not Available
10-01-2006
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
♦Prevents the establishment of the cellular antiviral state by inhibiting TRIM25-mediated DDX58 ubiquitination, which normally triggers the antiviral transduction signal that leads to the activation of type I IFN genes by transcription factors IRF3 and IRF7. Prevents human EIF2AK2/PKR activation, either by binding double-strand RNA, or by interacting directly with EIF2AK2/PKR. This function may be important at the very beginning of the infection, when NS1 is mainly present in the cytoplasm. Also binds poly(A) and U6 snRNA.
♦ Inhibits post-transcriptional processing of cellular pre-mRNA, by binding and inhibiting two cellular proteins that are required for the 3'-end processing of cellular pre-mRNAs: the 30 kDa cleavage and polyadenylation specificity factor/CPSF4 and the poly(A)-binding protein 2/PABPN1. In turn, unprocessed 3' end pre-mRNAs accumulate in the host nucleus and are no longer exported to the cytoplasm. Cellular protein synthesis is thereby shut off very early after virus infection. Viral protein synthesis is not affected by the inhibition of the cellular 3' end processing machinery because the poly(A) tails of viral mRNAs are produced by the viral polymerase through a stuttering mechanism.
♦ Inhibits post-transcriptional processing of cellular pre-mRNA, by binding and inhibiting two cellular proteins that are required for the 3'-end processing of cellular pre-mRNAs: the 30 kDa cleavage and polyadenylation specificity factor/CPSF4 and the poly(A)-binding protein 2/PABPN1. In turn, unprocessed 3' end pre-mRNAs accumulate in the host nucleus and are no longer exported to the cytoplasm. Cellular protein synthesis is thereby shut off very early after virus infection. Viral protein synthesis is not affected by the inhibition of the cellular 3' end processing machinery because the poly(A) tails of viral mRNAs are produced by the viral polymerase through a stuttering mechanism.
Not Available
Host nucleus . Host cytoplasm . Note=In uninfected, transfected cells, NS1 is localized in the nucleus. Only in virus infected cells, the nuclear export signal is unveiled, presumably by a viral protein, and a fraction of NS1 is exported in the cytoplasm. .
Not Available
MOTIF 34 38 Nuclear localization signal. ; MOTIF 137 146 Nuclear export signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available