Reviewed
Epomops Franqueti (Franquet's Epauleted Fruit Bat) [TaxID: 77231]; Homo Sapiens (Human) [TaxID: 9606]; Myonycteris Torquata (Little Collared Fruit Bat) [TaxID: 77243]
VP40
Matrix protein VP40 (Membrane-associated protein VP40)
Zaire Ebolavirus (strain Gabon-94) (ZEBOV) (Zaire Ebola Virus)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Filoviridae> Ebolavirus> Zaire Ebolavirus> Ebola Virus> Zaire Ebolavirus (strain Gabon-94) (ZEBOV) (Zaire Ebola Virus)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGV
ADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSN
GALRPGISFHPKLRPILLPNKSGKKGNSADLTFPEKIQAIMTSLQDLKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAP
GDLTMVITQDCDTCHSPASLPAVIEK
ADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSN
GALRPGISFHPKLRPILLPNKSGKKGNSADLTFPEKIQAIMTSLQDLKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAP
GDLTMVITQDCDTCHSPASLPAVIEK
326
Not Available
Not Available
07-02-2006
Evidence at transcript level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Promotes virus assembly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma membrane. Specific interactions with membrane-associated GP and VP24 during the budding process may also occur. The hexamer form seems to be involved in budding. The octamer form binds RNA, and may play a role in genome replication (By similarity).
Not Available
♦ Virion membrane
♦ Peripheral membrane protein . Host late endosome membrane
♦ Peripheral membrane protein . Host cell membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Host endomembrane system
♦ Peripheral membrane protein . Note=In virion, localizes on the intravirional side of the membrane. In the host cell, it is found associated with virus-induced membrane proliferation foci and probably also in multivesicular bodies. These VP40-enriched membrane clusters are then redistributed to the plasma membrane where budding takes place. .
♦ Peripheral membrane protein . Host late endosome membrane
♦ Peripheral membrane protein . Host cell membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Host endomembrane system
♦ Peripheral membrane protein . Note=In virion, localizes on the intravirional side of the membrane. In the host cell, it is found associated with virus-induced membrane proliferation foci and probably also in multivesicular bodies. These VP40-enriched membrane clusters are then redistributed to the plasma membrane where budding takes place. .
Not Available
MOTIF 7 10 PTAP/PSAP motif.; MOTIF 10 13 PPXY motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available