viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
K1[Gene ID: 4961511 ]
Protein K1
Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Rhadinovirus> Human Herpesvirus 8 (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)> Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Various pathway(s) in which protein is involved
Not Available
MFLYVVCSLAVCFRGLLSLSLQSSPNLCPGVISTPYTLTCPSNTSLPTSWYCNDTRLLRVTQGTLTVDTLICNFSCVGQSGHRYSLWITWYAQPVLQTFC
GQPSNTVTCGQHVTLYCSTSGNNVTVWHLPNGQNETVSQTKYYNFTLMNQTEGCYACSNGLSSRLSNRLCFSARCANITPETHTVSVSSTTGFRTFATAP
TLFVMKEVKSTYLYIQEHLLVFMTLVALIGTMCGILGTIIFAHCQKQRDSNKTVPQQLQDYYSLHDLCTEDYTQPVDWY
279
Not Available
Not Available
15-05-2007
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Promotes host cell survival pathways and may contribute to pathogenesis by preventing infected cells from undergoing apoptosis. Acts in host B-cells by mimicking the activated B-cell receptor complex. The cytoplasmic tail of K1 can induce the phosphorylation of a number of different kinases, leading to the activation of survival signaling pathways.
Not Available
♦ Host membrane
♦ Single-pass type I membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available