Reviewed
Homo Sapiens (Human) [TaxID: 9606]
K1[Gene ID: 4961511 ]
Protein K1
Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Rhadinovirus> Human Herpesvirus 8 (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)> Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Various pathway(s) in which protein is involved
Not Available
MFLYVVCSLAVCFRGLLSLSLQSSPNLCPGVISTPYTLTCPSNTSLPTSWYCNDTRLLRVTQGTLTVDTLICNFSCVGQSGHRYSLWITWYAQPVLQTFC
GQPSNTVTCGQHVTLYCSTSGNNVTVWHLPNGQNETVSQTKYYNFTLMNQTEGCYACSNGLSSRLSNRLCFSARCANITPETHTVSVSSTTGFRTFATAP
TLFVMKEVKSTYLYIQEHLLVFMTLVALIGTMCGILGTIIFAHCQKQRDSNKTVPQQLQDYYSLHDLCTEDYTQPVDWY
GQPSNTVTCGQHVTLYCSTSGNNVTVWHLPNGQNETVSQTKYYNFTLMNQTEGCYACSNGLSSRLSNRLCFSARCANITPETHTVSVSSTTGFRTFATAP
TLFVMKEVKSTYLYIQEHLLVFMTLVALIGTMCGILGTIIFAHCQKQRDSNKTVPQQLQDYYSLHDLCTEDYTQPVDWY
279
Not Available
Not Available
15-05-2007
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Promotes host cell survival pathways and may contribute to pathogenesis by preventing infected cells from undergoing apoptosis. Acts in host B-cells by mimicking the activated B-cell receptor complex. The cytoplasmic tail of K1 can induce the phosphorylation of a number of different kinases, leading to the activation of survival signaling pathways.
Not Available
♦ Host membrane
♦ Single-pass type I membrane protein .
♦ Single-pass type I membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available