viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF4[Gene ID: 4961488 ]
Complement control protein (KCP)
Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Rhadinovirus> Human Herpesvirus 8 (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)> Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Various pathway(s) in which protein is involved
Not Available
MAFLRQTLWILWTFTMVIGQDNEKCSQKTLIGYRLKMSRDGDIAVGETVELRCRSGYTTYARNITATCLQGGTWSEPTATCNKKSCPNPGEIQNGKVIFH
GGQDALKYGANISYVCNEGYFLVGREYVRYCMIGASGQMAWSSSPPFCEKEKCHRPKIENGDFKPDKDYYEYNDAVHFECNEGYTLVGPHSIACAVNNTW
TSNMPTCELAGCKFPSVTHGYPIQGFSLTYKHKQSVTFACNDGFVLRGSPTITCNVTEWDPPLPKCVLEDIDDPNNSNPGRLHPTPNEKPNGNVFQRSNY
TEPPTKPEDTHTAATCDTNCEQPPKILPTSEGFNETTTSNTITKQLEDEKTTSQPNTHITSALTSMKAKGNFTNKTNNSTDLHIASTPTSQDDATPSIPS
VQTPNYNTNAPTRTLTSLHIEEGPSNSTTSEKATASTLSHNSHKNDTGGIYTTLNKTTQLPSTNKPTNSQAKSSTKPRVETHNKTTSNPAISLTDSADVP
QRPREPTLPPIFRPPASKNRYLEKQLVIGLLTAVALTCGLITLFHYLFFR
550
Not Available
Not Available
21-03-2006
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Inhibits the complement component of the host innate immune response. Regulates host C3 convertases, accelerating their decay, and acts as a cofactor for factor I degradation of C4b and C3b. Binds also heparin, and therefore may play two distinct roles when incorporated in virion membranes: immune evasion and host cell binding.
Not Available
GO:0016021  ;   GO:0033644  ;   GO:0039573  ;   GO:0055036  
♦ Host membrane
♦ Single-pass type I membrane protein . Virion membrane .
♦DOMAIN 23 83 Sushi 1.
♦ DOMAIN 84 150 Sushi 2.
♦ DOMAIN 151 209 Sushi 3.
♦ DOMAIN 210 268 Sushi 4.
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available