Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF17[Gene ID: 4961478;4961482 ]
♦Capsid scaffolding protein (Capsid protein P40) (Protease precursor) (pPR) [Cleaved into: Assemblin (EC 3.4.21.97) (Protease)
♦ Assembly protein (Capsid assembly protein)]
♦ Assembly protein (Capsid assembly protein)]
Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Rhadinovirus> Human Herpesvirus 8 (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)> Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Various pathway(s) in which protein is involved
Not Available
MAQGLYVGGFVDVVSCPKLEQELYLDPDQVTDYLPVTEPLPITIEHLPETEVGWTLGLFQVSHGIFCTGAITSPAFLELASRLADTSHVARAPVKNLPKE
PLLEILHTWLPGLSLSSIHPRELSQTPSGPVFQHVSLCALGRRRGTVAVYGHDAEWVVSRFSSVSKSERAHILQHVSSCRLEDLSTPNFVSPLETLMAKA
IDASFIRDRLDLLKTDRGVASILSPAYLKASQFPVGIQAVTPPRPAMNSSGQEDIISIPKSAFLSMLQSSIDGMKTTAAKMSHTLSGPGLMGCGGQMFPT
DHHLPSYVSNPAPPYGYAYKNPYDPWYYSPQLPGYRTGKRKRGAEDDEGHLFPGEEPAYHKDILSMSKNIAEIQSELKEMKLNGWHAGPPPSSSAAAAAV
DPHYRPHANSAAPCQFPTMKEHGGTYVHPPIYVQAPHGQFQQAAPILFAQPHVSHPPVSTGLAVVGAPPAEPTPASSTQSIQQQAPETTHTPCAAVEKDA
PTPNPTSNRVEASSRSSPKSKIRKMFCEELLNKQ
PLLEILHTWLPGLSLSSIHPRELSQTPSGPVFQHVSLCALGRRRGTVAVYGHDAEWVVSRFSSVSKSERAHILQHVSSCRLEDLSTPNFVSPLETLMAKA
IDASFIRDRLDLLKTDRGVASILSPAYLKASQFPVGIQAVTPPRPAMNSSGQEDIISIPKSAFLSMLQSSIDGMKTTAAKMSHTLSGPGLMGCGGQMFPT
DHHLPSYVSNPAPPYGYAYKNPYDPWYYSPQLPGYRTGKRKRGAEDDEGHLFPGEEPAYHKDILSMSKNIAEIQSELKEMKLNGWHAGPPPSSSAAAAAV
DPHYRPHANSAAPCQFPTMKEHGGTYVHPPIYVQAPHGQFQQAAPILFAQPHVSHPPVSTGLAVVGAPPAEPTPASSTQSIQQQAPETTHTPCAAVEKDA
PTPNPTSNRVEASSRSSPKSKIRKMFCEELLNKQ
534
VAR_SEQ 1 246 Missing (in isoform pAP)
Not Available
21-03-2006
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
♦Capsid scaffolding protein: Acts as a scaffold protein by binding major capsid protein in the cytoplasm, inducing the nuclear localization of both proteins. Multimerizes in the nucleus such as major capsid protein forms the icosahedral T=16 capsid. Autocatalytic cleavage releases the assembly protein, and subsequently abolishes interaction with major capsid protein. Cleavages products are evicted from the capsid before or during DNA packaging.
♦ Assemblin: Protease that plays an essential role in virion assembly within the nucleus. Catalyzes the cleavage of the assembly protein after formation of the spherical procapsid. By that cleavage, the capsid matures and gains its icosahedral shape. The cleavage sites seem to include -Ala-Ser-, -Ala-Ala-, as well as Ala-Thr bonds. Assemblin and cleavages products are evicted from the capsid before or during DNA packaging.
♦ Assembly protein: Plays a major role in capsid assembly. Acts as a scaffold protein by binding major capsid protein. Multimerizes in the nucleus such as major capsid protein forms the icosahedral T=16 capsid. Cleaved by assemblin after capsid completion. The cleavages products are evicted from the capsid before or during DNA packaging.
♦ Assemblin: Protease that plays an essential role in virion assembly within the nucleus. Catalyzes the cleavage of the assembly protein after formation of the spherical procapsid. By that cleavage, the capsid matures and gains its icosahedral shape. The cleavage sites seem to include -Ala-Ser-, -Ala-Ala-, as well as Ala-Thr bonds. Assemblin and cleavages products are evicted from the capsid before or during DNA packaging.
♦ Assembly protein: Plays a major role in capsid assembly. Acts as a scaffold protein by binding major capsid protein. Multimerizes in the nucleus such as major capsid protein forms the icosahedral T=16 capsid. Cleaved by assemblin after capsid completion. The cleavages products are evicted from the capsid before or during DNA packaging.
3.4.21.97
♦ Capsid scaffolding protein: Host cytoplasm .
♦ Assemblin: Host nucleus .
♦ Assembly protein: Host nucleus .
♦ Assemblin: Host nucleus .
♦ Assembly protein: Host nucleus .
Not Available
MOTIF 336 342 Nuclear localization signal.
X-ray crystallography (1)
♦ACT_SITE 46 46 Charge relay system.
♦ ACT_SITE 114 114 Charge relay system.
♦ ACT_SITE 134 134 Charge relay system.
♦ ACT_SITE 114 114 Charge relay system.
♦ ACT_SITE 134 134 Charge relay system.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available