viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF18[Gene ID: 4961499 ]
Protein UL79 homolog
Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Rhadinovirus> Human Herpesvirus 8 (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)> Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Various pathway(s) in which protein is involved
Not Available
MLGKYVCETEPLSPGLRRLMWRFLQNKNLNTFHAQELRFIHLVLCKMYNFGLNVYLLREATANAGTYDEVVLGRKVPAEVWKLVYDGLEEMGVSSEMLLC
EAYRDSLWMHLNDKVGLLRGLANYLFHRLGVTHDVRIAPENLVDGNFLFNLGSVLPCRLLLAAGYCLAFWGSDEHERWVRFFAQKLFICYLIVSGRLMPQ
RSLLVWASETGYPGPVEAVCRDIRSMYGIRTYAVSGYLPAPSEAQLAYLGAFNNNAV
257
Not Available
Not Available
15-05-2007
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the expression of late transcripts bridging viral DNA replication and late gene expression during infection.
Not Available
Host nucleus. Note=Localizes in replication compartments during virus infection. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available