viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF49[Gene ID: 4961448 ]
Protein ORF49
Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Rhadinovirus> Human Herpesvirus 8 (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)> Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Various pathway(s) in which protein is involved
Not Available
MTSRRPLKDHLFNHLFRYHYPSWDQILQELDTLSVATLNPDCHVPALNVEKTLYLAKTIQILVQHRQSEPYLVPAARANLAYSLQQLYKLGNDKIRGVIN
GMLPLVDAGCIGFERELIKGLPRVLTLQYPHTAPLESEPPTADCTEWCLSHFVGASGRLRSEVRDILTTHNGTCAPSFQWMASVVKKFFLVETVIYEDFQ
DTDFNVQLNLCFFWTAVVQMYQRCIYEQKLVHIISTSLTLLKSTARSFFAWYDLYRPNLGSAALVKYTEHLIRALTPDCSDVELGELCSHLHHCKHALFS
IQ
302
Not Available
Not Available
15-05-2007
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the activation the host JNK/p38 pathways necessary for KSHV reactivation from latency and for viral replication. Induces transcriptional activation through host JUN of several ORF50-responsive promoters.
Not Available
Not Available
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available