Reviewed
Homo Sapiens (Human) [TaxID: 9606]
K8[Gene ID: 4961462 ]
E3 SUMO-protein ligase K-bZIP (EC 2.3.2.-) (E3 SUMO-protein transferase K-bZIP)
Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Rhadinovirus> Human Herpesvirus 8 (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)> Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Various pathway(s) in which protein is involved
Not Available
MPRMKDIPTKSSPGTDNSEKDEAVIEEDLSLNGQPFFTDNTDGGENEVSWTSSLLSTYVGCQPPAIPVCETVIDLTAPSQSGAPGDEHLPCSLNAETKFH
IPDPSWTLSHTPPRGPHISQQLPTRRSKRRLHRKFEEERLCTKAKQGAGRPVPASVVKVGNITPHYGEELTRGDAVPAAPITPPYPRVQRPAQPTHVLFS
PVFVSLKAEVCDQSHSPTRKQGRYGRVSSKAYTRQLQQALEEKDAQLCFLAARLEAHKEQIIFLRDMLMRMCQQPASPTDAPLPPC
IPDPSWTLSHTPPRGPHISQQLPTRRSKRRLHRKFEEERLCTKAKQGAGRPVPASVVKVGNITPHYGEELTRGDAVPAAPITPPYPRVQRPAQPTHVLFS
PVFVSLKAEVCDQSHSPTRKQGRYGRVSSKAYTRQLQQALEEKDAQLCFLAARLEAHKEQIIFLRDMLMRMCQQPASPTDAPLPPC
286
Not Available
Not Available
21-03-2006
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a role in viral gene regulation and seems to be essential for KSHV reactivation. Disrupts host G1 cell cycle control thus allowing viral transcription and translation to proceed at the early stages of infection. Catalyzes its own SUMO modification as well as that of its interacting partners such as host TP53 AND RB1.
2.3.2.-
Not Available
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available