Reviewed
Homo Sapiens (Human) [TaxID: 9606]
SCP ORF65[Gene ID: 4961451 ]
Small capsomere-interacting protein
Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Rhadinovirus> Human Herpesvirus 8 (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)> Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Various pathway(s) in which protein is involved
Not Available
MSNFKVRDPVIQERLDHDYAHHPLVARMNTLDQGNMSQAEYLVQKRHYLVFLIAHHYYEAYLRRMGGIQRRDHLQTLRDQKPRERADRVSAASAYDAGTF
TVPSRPGPASGTTPGGQDSLGVSGSSITTLSSGPHSLSPASDILTTLSSTTETAAPAVADARKPPSGKKK
TVPSRPGPASGTTPGGQDSLGVSGSSITTLSSGPHSLSPASDILTTLSSTTETAAPAVADARKPPSGKKK
170
Not Available
Not Available
15-05-2007
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.
Not Available
Virion . Host nucleus .
Not Available
Not Available
Electron microscopy (1)
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available