Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Gag
♦Gag polyprotein (Pr65gag) (Core polyprotein) [Cleaved into: Matrix protein p15 (MA)
♦ RNA-binding phosphoprotein p12 (pp12)
♦ Capsid protein p30 (CA)
♦ Nucleocapsid protein p10 (NC-gag)]
♦ RNA-binding phosphoprotein p12 (pp12)
♦ Capsid protein p30 (CA)
♦ Nucleocapsid protein p10 (NC-gag)]
Xenotropic MuLV-related Virus (isolate VP42) (XMRV)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Gammaretrovirus> Unclassified Gammaretrovirus> Murine Leukemia-related Retroviruses> XMRV-related Viruses> Xenotropic MuLV-related Virus> Xenotropic MuLV-related Virus (isolate VP42) (XMRV)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MGQTVTTPLSLTLQHWGDVQRIASNQSVDVKKRRWVTFCSAEWPTFNVGWPQDGTFNLGIISQVKSRVFCPGPHGHPDQVPYIVTWEALAYDPPPWVKPF
VSPKPPPLPTAPVLPPGPSAQPPSRSALYPALTPSIKSKPPKPQVLPDSGGPLIDLLTEDPPPYGAQPSSSARENNEEEAATTSEVSPPSPMVSRLRGRR
DPPAADSTTSQAFPLRMGGDGQLQYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLITHQPTWDDCQQLLGTLLTGEEKQRVLLEARKAVRGNDGRPT
QLPNEVNAAFPLERPDWGYTTTEGRNHLVLYRQLLLAGLQNAGRSPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQETNVSMSFIWQSA
PDIGRKLERLEDLKSKTLGDLVREAEKIFNKRETPEEREERIRREIEEKEERRRAEDEQRERERDRRRHREMSKLLATVVIGQRQDRQGGERRRPQLDKD
QCAYCKEKGHWAKDCPKKPRGPRGPRPQTSLLTLGD
VSPKPPPLPTAPVLPPGPSAQPPSRSALYPALTPSIKSKPPKPQVLPDSGGPLIDLLTEDPPPYGAQPSSSARENNEEEAATTSEVSPPSPMVSRLRGRR
DPPAADSTTSQAFPLRMGGDGQLQYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLITHQPTWDDCQQLLGTLLTGEEKQRVLLEARKAVRGNDGRPT
QLPNEVNAAFPLERPDWGYTTTEGRNHLVLYRQLLLAGLQNAGRSPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQETNVSMSFIWQSA
PDIGRKLERLEDLKSKTLGDLVREAEKIFNKRETPEEREERIRREIEEKEERRRAEDEQRERERDRRRHREMSKLLATVVIGQRQDRQGGERRRPQLDKD
QCAYCKEKGHWAKDCPKKPRGPRGPRPQTSLLTLGD
536
Not Available
Not Available
21-03-2006
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
♦Gag polyprotein plays a role in budding and is processed by the viral protease during virion maturation outside the cell. During budding, it recruits, in a PPXY-dependent or independent manner, Nedd4-like ubiquitin ligases that conjugate ubiquitin molecules to Gag, or to Gag binding host factors. Interaction with HECT ubiquitin ligases probably link the viral protein to the host ESCRT pathway and facilitate release (By similarity).
♦ Matrix protein p15 targets Gag and gag-pol polyproteins to the plasma membrane via a multipartite membrane binding signal, that includes its myristoylated N-terminus. Also mediates nuclear localization of the preintegration complex (By similarity).
♦ Capsid protein p30 forms the spherical core of the virion that encapsulates the genomic RNA-nucleocapsid complex.
♦ Nucleocapsid protein p10 is involved in the packaging and encapsidation of two copies of the genome. Binds with high affinity to conserved elements within the packaging signal, located near the 5'-end of the genome. This binding is dependent on genome dimerization (By similarity).
♦ Matrix protein p15 targets Gag and gag-pol polyproteins to the plasma membrane via a multipartite membrane binding signal, that includes its myristoylated N-terminus. Also mediates nuclear localization of the preintegration complex (By similarity).
♦ Capsid protein p30 forms the spherical core of the virion that encapsulates the genomic RNA-nucleocapsid complex.
♦ Nucleocapsid protein p10 is involved in the packaging and encapsidation of two copies of the genome. Binds with high affinity to conserved elements within the packaging signal, located near the 5'-end of the genome. This binding is dependent on genome dimerization (By similarity).
Not Available
GO:0003723 ; GO:0005198 ; GO:0008270 ; GO:0016020 ; GO:0019013 ;
GO:0020002 ; GO:0039702 ; GO:0044185 ; GO:0072494
GO:0020002 ; GO:0039702 ; GO:0044185 ; GO:0072494
♦ Gag polyprotein: Virion . Host cell membrane
♦ Lipid-anchor . Host late endosome membrane
♦ Lipid-anchor . Host endosome, host multivesicular body . Note=These locations are probably linked to virus assembly sites. .
♦ Matrix protein p15: Virion .
♦ Capsid protein p30: Virion .
♦ Nucleocapsid protein p10: Virion .
♦ Lipid-anchor . Host late endosome membrane
♦ Lipid-anchor . Host endosome, host multivesicular body . Note=These locations are probably linked to virus assembly sites. .
♦ Matrix protein p15: Virion .
♦ Capsid protein p30: Virion .
♦ Nucleocapsid protein p10: Virion .
Not Available
MOTIF 109 112 PTAP/PSAP motif.; MOTIF 128 132 LYPX(n)L motif.; MOTIF 161 164 PPXY motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available