Reviewed
Chlorocebus Aethiops (Green Monkey) (Cercopithecus Aethiops) [TaxID: 9534]; Homo Sapiens (Human) [TaxID: 9606]; Rousettus Aegyptiacus (Egyptian Rousette) (Egyptian Fruit Bat) [TaxID: 9407]
VP24
Membrane-associated protein VP24
Lake Victoria Marburgvirus (strain Ravn-87) (MARV) (Marburg Virus (strain Kenya/Ravn/1987))
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Filoviridae> Marburgvirus> Marburg Marburgvirus> Lake Victoria Marburgvirus (strain Ravn-87) (MARV) (Marburg Virus (strain Kenya/Ravn/1987))
Various pathway(s) in which protein is involved
Not Available
Not Available
MAELSTRYNLPTNITEKSINLDLNSTARWVKEPSVGGWTVKWGNFIFHIPNTGMTLLHHLKSNFVVPEWQQTRSLFSHLFKNPKSTIMEPFLALRILLGV
ALKDQELQQSLIPGFRSIVHMLSEWLLLEVTSAIHISPNLLGIYLTSDMFKILMAGVKNFFNKLFTLHVVNDHGKPSSIEIKLTGQQIIITRVNMGFLVE
VRRIDIEPCCGETVLSESVVFGLVAEAVLREHSQIERGQPLNLTQYMNSKIAI
ALKDQELQQSLIPGFRSIVHMLSEWLLLEVTSAIHISPNLLGIYLTSDMFKILMAGVKNFFNKLFTLHVVNDHGKPSSIEIKLTGQQIIITRVNMGFLVE
VRRIDIEPCCGETVLSESVVFGLVAEAVLREHSQIERGQPLNLTQYMNSKIAI
253
Not Available
Not Available
16-05-2006
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
May act as a minor matrix protein that plays a role in assembly of viral nucleocapsid and virion budding.
Not Available
♦ Virion membrane
♦ Peripheral membrane protein . Host cell membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Host endomembrane system
♦ Peripheral membrane protein . Note=In virion, localizes on the intravirional side of the membrane. In the host cell, it is found associated with virus-induced membrane proliferation foci and to the plasma membrane where budding takes place (By similarity). .
♦ Peripheral membrane protein . Host cell membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Host endomembrane system
♦ Peripheral membrane protein . Note=In virion, localizes on the intravirional side of the membrane. In the host cell, it is found associated with virus-induced membrane proliferation foci and to the plasma membrane where budding takes place (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available