Reviewed
Homo Sapiens (Human) [TaxID: 9606]
BZLF2[Gene ID: 5176170 ]
Glycoprotein 42 (gp42)
Epstein-Barr Virus (strain AG876) (HHV-4) (Human Herpesvirus 4)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Lymphocryptovirus> Epstein-Barr Virus (strain GD1) (HHV-4) (Human Herpesvirus 4)> Epstein-Barr Virus (strain AG876) (HHV-4) (Human Herpesvirus 4)
Various pathway(s) in which protein is involved
Not Available
MVSFKQVRVPLFTAIALVIVLLLAYFLPPRVRGGGRVSAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEIKLPHWTPTLHTFQVPKNYTKANCT
YCNTREYTFSYKERCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFST
VPVSHHECSFLKPCLCVSQRSNS
YCNTREYTFSYKERCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFST
VPVSHHECSFLKPCLCVSQRSNS
223
Not Available
Not Available
13-06-2006
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a role in virion attachment to host B-lymphocytes, through binding to leukocyte antigen (HLA) class II and subsequently participates in fusion of the virion with host membranes. May act as a tropism switch that directs fusion with B-lymphocytes and inhibits fusion with epithelial cells (By similarity).
Not Available
♦ Virion membrane. Note=virions synthesized in B-lymphocytes contain a lower amount of gp42 due to sequestration by cellular HLA class II protein, whereas virions made from epithelial cells has a higher amount of gp42. Membrane
♦ Single-pass membrane protein (By similarity). .
♦ Single-pass membrane protein (By similarity). .
DOMAIN 111 217 C-type lectin.
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available