Reviewed
Homo Sapiens (Human) [TaxID: 9606]
HE 2
Hemagglutinin-esterase (HE protein) (EC 3.1.1.53) (E3 glycoprotein)
Human Coronavirus HKU1 (isolate N2) (HCoV-HKU1)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Nidovirales> Coronaviridae> Coronavirinae> Betacoronavirus> Human Coronavirus HKU1 (HCoV-HKU1)> Human Coronavirus HKU1 (isolate N2) (HCoV-HKU1)
Various pathway(s) in which protein is involved
Not Available
Not Available
MLIIFLFFNFCYGFNEPLNVVSHLNHDWFLFGDSRSDCNHINNLKIKNYGYLDIHPSLCNNGKISSSAGDSIFKSYHFTRFYNYTGEGDQIIFYEGVNFN
PHHRFKCFFNGSNDVWIFNKVRFYRALYSNMALFRYLTFVDILYNFSFSIKANICNSNILSLNNPIFISTNYSKDVYFTLSGCSLYLVPLCLFKSNFSQY
YYNMDTGFAYGYSNFVSSDLDCTYISLKPGSYKIFSTGFVLSIPTKALCFNKSKQFVPVQVVDSRWNNLRASDTSLSDACQLPYCYFRNSSGNYVGKYDI
NHGDNGFTSILSGLLYNVSCISYYGSFLYDNFTSIWPRFSFGNCPTSAYIKLNCFYDPLPIILQGILLFLALLFIVFLLFLVYHG
PHHRFKCFFNGSNDVWIFNKVRFYRALYSNMALFRYLTFVDILYNFSFSIKANICNSNILSLNNPIFISTNYSKDVYFTLSGCSLYLVPLCLFKSNFSQY
YYNMDTGFAYGYSNFVSSDLDCTYISLKPGSYKIFSTGFVLSIPTKALCFNKSKQFVPVQVVDSRWNNLRASDTSLSDACQLPYCYFRNSSGNYVGKYDI
NHGDNGFTSILSGLLYNVSCISYYGSFLYDNFTSIWPRFSFGNCPTSAYIKLNCFYDPLPIILQGILLFLALLFIVFLLFLVYHG
385
Not Available
Not Available
22-08-2006
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Structural protein that makes short spikes at the surface of the virus. Contains receptor binding and receptor-destroying activities. Mediates de-O-acetylation of N-acetyl-4-O-acetylneuraminic acid, which is probably the receptor determinant recognized by the virus on the surface of erythrocytes and susceptible cells. This receptor-destroying activity is important for virus release as it probably helps preventing self-aggregation and ensures the efficient spread of the progeny virus from cell to cell. May serve as a secondary viral attachment protein for initiating infection, the spike protein being the major one. May become a target for both the humoral and the cellular branches of the immune system.
3.1.1.53
♦ Virion membrane
♦ Single-pass type I membrane protein . Host cell membrane
♦ Single-pass type I membrane protein . Note=In infected cells becomes incorporated into the envelope of virions during virus assembly at the endoplasmic reticulum and cis Golgi. However, some may escape incorporation into virions and subsequently migrate to the cell surface. .
♦ Single-pass type I membrane protein . Host cell membrane
♦ Single-pass type I membrane protein . Note=In infected cells becomes incorporated into the envelope of virions during virus assembly at the endoplasmic reticulum and cis Golgi. However, some may escape incorporation into virions and subsequently migrate to the cell surface. .
Not Available
Not Available
Predicted/Modelled
Not Available
♦ACT_SITE 34 34 Nucleophile.
♦ ACT_SITE 299 299 Charge relay system.
♦ ACT_SITE 302 302 Charge relay system.
♦ ACT_SITE 299 299 Charge relay system.
♦ ACT_SITE 302 302 Charge relay system.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available