viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
N 7a
Nucleoprotein (Nucleocapsid protein) (NC) (Protein N)
Human Coronavirus HKU1 (isolate N2) (HCoV-HKU1)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Nidovirales> Coronaviridae> Coronavirinae> Betacoronavirus> Human Coronavirus HKU1 (HCoV-HKU1)> Human Coronavirus HKU1 (isolate N2) (HCoV-HKU1)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSYTPGHHAGSRSSSGNRSGILKKTSWVDQSERSHQTYNRGRKPQPKFTVSTQPQGNPIPHYSWFSGITQFQKGRDFKFPDGQGVPIAYGIPPSEAKGYW
YKHNRRSFKTADGQQKQLLPRWYFYYLGTGPYASSSYGDAHEGIFWVASHQADTSIPSDVSARDPTIQEAIPTRFSPGTILPQGYYVEGSGRSASNSRPG
SRSQSRGPNNRSLSRSNSNFRHSDSIVKPDMADEIASLVLAKLGKDSKPQQVTKQNAKEIRHKILMKPRQKRTPNKFCNVQQCFGKRGPLQNFGNSEMLK
LGTNDPQFPILAELAPTPGAFFFGSKLELFKRDSDADSPSKDTFELRYSGSIRFDSTLPGFETIMKVLKENLDAYVNSNQNTVSGSLSPKPQRKRGVKQS
PESFDSLNLSADTQHISNDFTPEDHSLLATLDDPYVEDSVA
441
Not Available
Not Available
24-07-2007
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Not Available
GO:0003723  ;   GO:0019013  ;   GO:0044172  ;   GO:0044177  ;   GO:0044196  ;  
GO:0044220  
Virion . Host endoplasmic reticulum-Golgi intermediate compartment . Host Golgi apparatus . Note=Located inside the virion, complexed with the viral RNA. Probably associates with ER-derived membranes where it participates in viral RNA synthesis and virus budding. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available