Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Gag
♦Gag polyprotein (Pr53Gag) [Cleaved into: Matrix protein p19 (MA)
♦ Capsid protein p24 (CA)
♦ Nucleocapsid protein p15-gag (NC-gag)]
♦ Capsid protein p24 (CA)
♦ Nucleocapsid protein p15-gag (NC-gag)]
Human T-cell Leukemia Virus 3 (strain 2026ND) (HTLV-3)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Deltaretrovirus> Primate T-lymphotropic Virus 3> Human T-cell Leukemia Virus 3 (HTLV-3) (Human T-lymphotropic Virus 3)> Human T-cell Leukemia Virus 3 (strain 2026ND) (HTLV-3)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MGKTYSSPINPIPKAPKGLAIHHWLNFLQAAYRLQPGPSEFDFHQLRKFLKLAIKTPVWLNPINYSVLAGLIPKNYPGRVHEIVAILIQETPAREAPPSA
PLAEDPQKPPPYPEQAQEASQCLPILHPHGAPAAHRPWQMKDLQAIKQEVSSSAPGSPQFMQTIRLAVQQFDPTAKDLHDLLQYLCSSLVASLHHQQLET
LIAQAETQGITGYNPLAGPLRIQANNPNQQGLRKEYQNLWLSAFSALPGNTKDPTWAAILQGPEEPFGSFVERLNVALDNGLPEGTPKDPILRSLAYSNA
NKECQKLLQARGQTNSPLGEMLRACQTWTPRDKNKILMVQPKKTPPPNQPCFRCGQVGHWSRDCKQPRPPPGPCPVCQDPTHWKRDCPQLKTDTRDSEDL
LLDLPCEAPNVRERKNSSGGED
PLAEDPQKPPPYPEQAQEASQCLPILHPHGAPAAHRPWQMKDLQAIKQEVSSSAPGSPQFMQTIRLAVQQFDPTAKDLHDLLQYLCSSLVASLHHQQLET
LIAQAETQGITGYNPLAGPLRIQANNPNQQGLRKEYQNLWLSAFSALPGNTKDPTWAAILQGPEEPFGSFVERLNVALDNGLPEGTPKDPILRSLAYSNA
NKECQKLLQARGQTNSPLGEMLRACQTWTPRDKNKILMVQPKKTPPPNQPCFRCGQVGHWSRDCKQPRPPPGPCPVCQDPTHWKRDCPQLKTDTRDSEDL
LLDLPCEAPNVRERKNSSGGED
422
Not Available
Not Available
23-01-2007
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
♦Matrix protein p19 targets Gag, Gag-Pro and Gag-Pro-Pol polyproteins to the plasma membrane via a multipartite membrane binding signal, that includes its myristoylated N-terminus. Also mediates nuclear localization of the preintegration complex (By similarity).
♦ Capsid protein p24 forms the conical core of the virus that encapsulates the genomic RNA-nucleocapsid complex.
♦ Nucleocapsid protein p15 is involved in the packaging and encapsidation of two copies of the genome.
♦ Capsid protein p24 forms the conical core of the virus that encapsulates the genomic RNA-nucleocapsid complex.
♦ Nucleocapsid protein p15 is involved in the packaging and encapsidation of two copies of the genome.
Not Available
♦ Matrix protein p19: Virion .
♦ Capsid protein p24: Virion .
♦ Nucleocapsid protein p15-gag: Virion .
♦ Capsid protein p24: Virion .
♦ Nucleocapsid protein p15-gag: Virion .
Not Available
MOTIF 98 101 PTAP/PSAP motif.; MOTIF 109 112 PPXY motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available