viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Gag-pro
♦Gag-Pro polyprotein (Pr76Gag-Pro) [Cleaved into: Matrix protein p19 (MA)
♦ Capsid protein p24 (CA)
♦ Nucleocapsid protein p15-pro (NC') (NC-pro)
♦ Protease (PR) (EC 3.4.23.-)
♦ p1
♦ Transframe peptide (TFP) (p8) (pX)]
Human T-cell Leukemia Virus 3 (strain 2026ND) (HTLV-3)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Deltaretrovirus> Primate T-lymphotropic Virus 3> Human T-cell Leukemia Virus 3 (HTLV-3) (Human T-lymphotropic Virus 3)> Human T-cell Leukemia Virus 3 (strain 2026ND) (HTLV-3)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MGKTYSSPINPIPKAPKGLAIHHWLNFLQAAYRLQPGPSEFDFHQLRKFLKLAIKTPVWLNPINYSVLAGLIPKNYPGRVHEIVAILIQETPAREAPPSA
PLAEDPQKPPPYPEQAQEASQCLPILHPHGAPAAHRPWQMKDLQAIKQEVSSSAPGSPQFMQTIRLAVQQFDPTAKDLHDLLQYLCSSLVASLHHQQLET
LIAQAETQGITGYNPLAGPLRIQANNPNQQGLRKEYQNLWLSAFSALPGNTKDPTWAAILQGPEEPFGSFVERLNVALDNGLPEGTPKDPILRSLAYSNA
NKECQKLLQARGQTNSPLGEMLRACQTWTPRDKNKILMVQPKKTPPPNQPCFRCGQVGHWSRDCKQPRPPPGPCPVCQDPTHWKRDCPQLKTDTRDSEDL
LLDLPCEAPNVRERKNLLRGGGLASPRTILPLIPLSQQKQPTLHIQVSFSNTPPVSVQALLDTGADITVLPACLCPPDSNLQDTTVLGAGGPSTNKFKIL
PCPVHIHLPFRRQPVTLTACLIDINNQWTILGRDALQQCQSSLYLADQPSKVLPVLAPKLIGLEHLPPPPEVSQFPLNQSASRL
584
Not Available
Not Available
23-01-2007
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
♦Matrix protein p19 targets Gag, Gag-Pro and Gag-Pro-Pol polyproteins to the plasma membrane via a multipartite membrane binding signal, that includes its myristoylated N-terminus. Also mediates nuclear localization of the preintegration complex (By similarity).
♦ Capsid protein p24 forms the conical core of the virus that encapsulates the genomic RNA-nucleocapsid complex.
♦ Nucleocapsid protein p15 is involved in the packaging and encapsidation of two copies of the genome.
♦ The aspartyl protease mediates proteolytic cleavages of Gag, Gag-Pro and Gag-Pro-Pol polyproteins during or shortly after the release of the virion from the plasma membrane. Cleavages take place as an ordered, step-wise cascade to yield mature proteins. This process is called maturation. Displays maximal activity during the budding process just prior to particle release from the cell. Hydrolyzes host EIF4GI in order to shut off the capped cellular mRNA translation. The resulting inhibition of cellular protein synthesis serves to ensure maximal viral gene expression and to evade host immune response (By similarity).
3.4.23.-  
GO:0003676  ;   GO:0004190  ;   GO:0005198  ;   GO:0008270  ;   GO:0019013  ;  
GO:0039657  
♦ Matrix protein p19: Virion .
♦ Capsid protein p24: Virion .
♦ Nucleocapsid protein p15-pro: Virion .
DOMAIN 457 535 Peptidase A2.
MOTIF 98 101 PTAP/PSAP motif.; MOTIF 109 112 PPXY motif.
Predicted/Modelled
Not Available
♦ACT_SITE 462 462 For protease activity
♦ shared with dimeric partner.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available