viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Non-structural protein 3 (NSP3) (NCVP4) (Non-structural RNA-binding protein 34) (NS34)
Rotavirus X (isolate RVX/Human/Bangladesh/NADRV-B219/2002/GXP[X]) (RV ADRV-N) (Rotavirus (isolate Novel Adult Diarrhea Rotavirus-B219))
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Unclassified Rotaviruses> Rotavirus X (isolate RVX/Human/Bangladesh/NADRV-B219/2002/GXP[X]) (RV ADRV-N) (Rotavirus (isolate Novel Adult Diarrhea Rotavirus-B219))
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MAELVCDALATLTRNTYGNNDESAKFCRMFRAMIRDSGLYSNIENWRAAFYRDRLPKRMSHSTVSIQLDNLEREVLKIRAEGFCQGYTRKERTLNAFDLG
DDGKGNTIIKPTTHLSSIILQNSYNSAFKLPKIPDGLLEKTRCELEEEKKNNDVLKQKIKELENTISQLENFENEAKASEFVLEHLKFTNESLRIQRDEA
QICLVGLCNKFGLQCEIDNSIRVTESDKKGKRKGRKNRRTEVSFGAPGHNLTDQINALSDVE
262
Not Available
Not Available
03-10-2006
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
May play a role in stimulating the translation of viral mRNAs.
Not Available
Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available