Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Rex
Protein Rex (Rev homolog) (Rex-3)
Human T-cell Leukemia Virus 3 (strain Pyl43) (HTLV-3)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Deltaretrovirus> Primate T-lymphotropic Virus 3> Human T-cell Leukemia Virus 3 (strain Pyl43) (HTLV-3)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MPKTRKQRSRRPRNQRPSTPWPISQVSDRAFSTGTLSTFSATVYRPIGAPFLGGFVPLGYTAMPCWPRAPNIRLPGTPSMDALSAQLYNTLSLGSPPSPP
KELPAPSRFSPPQPLLRPPRFLHPSSTPLKNTPPSETIASSSPWESSCQPCPSPTLGSGPKTSTPYGAAPSCVSTSISSPPP
KELPAPSRFSPPQPLLRPPRFLHPSSTPLKNTPPSETIASSSPWESSCQPCPSPTLGSGPKTSTPYGAAPSCVSTSISSPPP
182
Not Available
Not Available
17-10-2006
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Rex escorts unspliced gag-pro-pol and singly spliced env mRNAs out of the nucleus of infected cells. These mRNAs carry a recognition sequence called Rex responsive element (RxRE or XRE) located at the 3' region of the long terminal repeat (LTR). This function is essential since most HTLV proteins are translated from unspliced or partially spliced pre-mRNAs that cannot exit the nucleus by the pathway used by fully processed cellular mRNAs (By similarity).
Not Available
Host nucleus, host nucleolus . Host cytoplasm . Note=The presence of both nuclear import (NLS) and nuclear export (NES) signals leads to continuous shuttling between the nucleus and cytoplasm. .
Not Available
MOTIF 2 19 Nuclear localization signal, and RNA-binding (RxRE). ; MOTIF 83 94 Nuclear export signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available