Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Env
♦Envelope glycoprotein gp63 (Env polyprotein) [Cleaved into: Surface protein (SU) (Glycoprotein 46) (gp46)
♦ Transmembrane protein (TM) (Glycoprotein 21) (gp21)]
♦ Transmembrane protein (TM) (Glycoprotein 21) (gp21)]
Human T-cell Leukemia Virus 3 (strain Pyl43) (HTLV-3)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Deltaretrovirus> Primate T-lymphotropic Virus 3> Human T-cell Leukemia Virus 3 (strain Pyl43) (HTLV-3)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MGKSGLYFSLICFYTLFPSSFGNPSRCTLFIGASSYHSDPCGSNHPRCTWRLDLFSLTKDQSLSPPCPGLVTYSQYHKPYSLYVFPHWIAKPDRRGLGYY
SASYSDPCAIQCPYLGCQSWTCPYTGPVSNPHWKYTSDLNFTQEVSSISLHLHFSKCGSSFSFLLDAPGYDPVWLLSSQATQIPPTPAPLIQDSDLQHIL
EPSIPWSSKILNLILLALKSTNYSCMVCVDRSSLSSWHVLYDPLKAPSSPDPQAQSILRPSLAIPASNITPPFPWTHCYRPPLQAISSENCNNSVILPPF
SLSPIPDVSRPRKRRAVPIAIWLVSALAAGTGIAGGVTGSLSLASSKSLLREVDQDIDHLTRAIVKNHDNILRVAQYAAQNRRGLDLLFWEQGGLCKAIQ
EQCCFLNISNTHVSVLQERPPLEKRVITGWGLNWDLGLSQWAREALQTGITLLALFLLLIVVGPCVIRQLQTLPSRLQHRSQPYSLLNYETNL
SASYSDPCAIQCPYLGCQSWTCPYTGPVSNPHWKYTSDLNFTQEVSSISLHLHFSKCGSSFSFLLDAPGYDPVWLLSSQATQIPPTPAPLIQDSDLQHIL
EPSIPWSSKILNLILLALKSTNYSCMVCVDRSSLSSWHVLYDPLKAPSSPDPQAQSILRPSLAIPASNITPPFPWTHCYRPPLQAISSENCNNSVILPPF
SLSPIPDVSRPRKRRAVPIAIWLVSALAAGTGIAGGVTGSLSLASSKSLLREVDQDIDHLTRAIVKNHDNILRVAQYAAQNRRGLDLLFWEQGGLCKAIQ
EQCCFLNISNTHVSVLQERPPLEKRVITGWGLNWDLGLSQWAREALQTGITLLALFLLLIVVGPCVIRQLQTLPSRLQHRSQPYSLLNYETNL
493
Not Available
Not Available
17-10-2006
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
♦The surface protein (SU) attaches the virus to the host cell by binding to its receptor. This interaction triggers the refolding of the transmembrane protein (TM) and is thought to activate its fusogenic potential by unmasking its fusion peptide. Fusion occurs at the host cell plasma membrane (By similarity).
♦ The transmembrane protein (TM) acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Membranes fusion leads to delivery of the nucleocapsid into the cytoplasm (By similarity).
♦ The transmembrane protein (TM) acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Membranes fusion leads to delivery of the nucleocapsid into the cytoplasm (By similarity).
Not Available
♦ Transmembrane protein: Virion membrane
♦ Single-pass type I membrane protein . Host cell membrane
♦ Single-pass type I membrane protein . Note=It is probably concentrated at the site of budding and incorporated into the virions possibly by contacts between the cytoplasmic tail of Env and the N-terminus of Gag. .
♦ Surface protein: Virion membrane
♦ Peripheral membrane protein . Host cell membrane
♦ Peripheral membrane protein . Note=The surface protein is not anchored to the viral envelope, but associates with the extravirion surface through its binding to TM. It is probably concentrated at the site of budding and incorporated into the virions possibly by contacts between the cytoplasmic tail of Env and the N-terminus of Gag (By similarity). .
♦ Single-pass type I membrane protein . Host cell membrane
♦ Single-pass type I membrane protein . Note=It is probably concentrated at the site of budding and incorporated into the virions possibly by contacts between the cytoplasmic tail of Env and the N-terminus of Gag. .
♦ Surface protein: Virion membrane
♦ Peripheral membrane protein . Host cell membrane
♦ Peripheral membrane protein . Note=The surface protein is not anchored to the viral envelope, but associates with the extravirion surface through its binding to TM. It is probably concentrated at the site of budding and incorporated into the virions possibly by contacts between the cytoplasmic tail of Env and the N-terminus of Gag (By similarity). .
Not Available
MOTIF 225 228 CXXC. ; MOTIF 396 404 CX6CC.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available