Reviewed
Aves [TaxID: 8782]; Cetacea (whales) [TaxID: 9721]; Homo Sapiens (Human) [TaxID: 9606]; Phocidae (true Seals) [TaxID: 9709]; Sus Scrofa (Pig) [TaxID: 9823]
NP
Nucleoprotein (Nucleocapsid protein) (Protein N)
Influenza A Virus (strain A/Memphis/4/1973 H3N2)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Alphainfluenzavirus> Influenza A Virus> H3N2 Subtype> Influenza A Virus (strain A/Memphis/4/1973 H3N2)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MASQGTKRSYEQMETDGERQNATEIRASVGKMIDGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSAFDERRNRYLEEHPSAGKDPKKTGGPIYKRV
DGKWMRELVLYDKEEIRRIWRQANNGDDATRGLTHMMIWHSNLNDTTYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRG
INDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEYEDLIFLARSALILRGSVAHKSCLPACVYGPAVASGYDFEKEGYSLVG
IDPFKLLQNSQVYSLIRPNENPAHKSQLVWMACNSAAFEDLRLLSFIRGTKVFPRGKLSTRGVQIASNENMDTMESSTLELRSRYWAIRTRSGGNTNQQR
ASAGQISVQPAFSVQKNLPFDKSTIMAAFTGNTEGRTSDMRAEIIRMMEGAKPEEVSFRGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAEEYDN
DGKWMRELVLYDKEEIRRIWRQANNGDDATRGLTHMMIWHSNLNDTTYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRG
INDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEYEDLIFLARSALILRGSVAHKSCLPACVYGPAVASGYDFEKEGYSLVG
IDPFKLLQNSQVYSLIRPNENPAHKSQLVWMACNSAAFEDLRLLSFIRGTKVFPRGKLSTRGVQIASNENMDTMESSTLELRSRYWAIRTRSGGNTNQQR
ASAGQISVQPAFSVQKNLPFDKSTIMAAFTGNTEGRTSDMRAEIIRMMEGAKPEEVSFRGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAEEYDN
498
Not Available
Not Available
01-02-1995
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Encapsidates the negative strand viral RNA, protecting it from nucleases. The encapsidated genomic RNA is termed the ribonucleoprotein (RNP) and serves as template for transcription and replication. The RNP needs to be localized in the host nucleus to start an infectious cycle, but is too large to diffuse through the nuclear pore complex. NP comprises at least 2 nuclear localization signals that are responsible for the active RNP import into the nucleus through cellular importin alpha/beta pathway. Later in the infection, nclear export of RNPs are mediated through viral proteins NEP interacting with M1 which binds nucleoproteins. It is possible that nucleoprotein binds directly host exportin-1/XPO1 and plays an active role in RNPs nuclear export. M1 interaction with RNP seems to hide nucleoprotein's nuclear localization signals. Soon after a virion infects a new cell, M1 dissociates from the RNP under acidification of the virion driven by M2 protein. Dissociation of M1 from RNP unmasks nucleoprotein's nuclear localization signals, targeting the RNP to the nucleus.
Not Available
Virion . Host nucleus .
Not Available
MOTIF 1 18 Unconventional nuclear localization signal. ; MOTIF 198 216 Bipartite nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available