Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Outer capsid glycoprotein VP7
Rotavirus A (isolate RVA/Human/United Kingdom/A64/1987/G10P11[14]) (RV-A)
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Rotavirus A> Rotavirus G10> Rotavirus G10P11> Rotavirus A (isolate RVA/Human/United Kingdom/A64/1987/G10P11[14]) (RV-A)
NC_011500.2 ; NC_011501.2 ; NC_011502.2 ; NC_011503.2 ; NC_011504.2 ; NC_011505.2 ; NC_011506.2 ;
NC_011507.2 ; NC_011508.2 ; NC_011509.2 ; NC_011510.2 ; NC_011511.2
NC_011507.2 ; NC_011508.2 ; NC_011509.2 ; NC_011510.2 ; NC_011511.2
Various pathway(s) in which protein is involved
Not Available
Not Available
MYGIEYTTFLIYLISIILFNYILKSITRMMDYIIYKFLLIITITSIFDSAQNYGINLPITGSMDVSYVNATKDEPFLTSTLCLYYPTEARTEINDNEWTS
TLSQLFLTKGWPTGSVYFKEYDDIPTFSVDPQLYCDYNIVLMRYNSSLKLDMSELANLILNEWLCNPMDITLYYYQQTDEANKWIAMGQSCTIKVCPLNT
QTLGIGCQTTNTGTFEEVATAEKLVITDVVDGVNHKLDVTTASRTIRNCKKLGPRENVAVIQIGGADILDITSDPTTTPQTERMMRINWKKWWQVFYTIV
DYVNQIVQTMSKRSRSLDSAAFYYRV
TLSQLFLTKGWPTGSVYFKEYDDIPTFSVDPQLYCDYNIVLMRYNSSLKLDMSELANLILNEWLCNPMDITLYYYQQTDEANKWIAMGQSCTIKVCPLNT
QTLGIGCQTTNTGTFEEVATAEKLVITDVVDGVNHKLDVTTASRTIRNCKKLGPRENVAVIQIGGADILDITSDPTTTPQTERMMRINWKKWWQVFYTIV
DYVNQIVQTMSKRSRSLDSAAFYYRV
326
VAR_SEQ 1 29 Missing (in isoform 2)
Not Available
01-11-1996
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Calcium-binding protein that interacts with rotavirus cell receptors once the initial attachment by VP4 has been achieved. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. Following entry into the host cell, low intracellular or intravesicular Ca(2+) concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7.
Not Available
♦ Virion . Host endoplasmic reticulum lumen . Note=The outer layer contains 780 copies of VP7, grouped as 260 trimers. Immature double-layered particles assembled in the cytoplasm bud across the membrane of the endoplasmic reticulum, acquiring during this process a transient lipid membrane that is modified with the ER resident viral glycoproteins NSP4 and VP7
♦ these enveloped particles also contain VP4. As the particles move towards the interior of the ER cisternae, the transient lipid membrane and the non-structural protein NSP4 are lost, while the virus surface proteins VP4 and VP7 rearrange to form the outermost virus protein layer, yielding mature infectious triple-layered particles. .
♦ these enveloped particles also contain VP4. As the particles move towards the interior of the ER cisternae, the transient lipid membrane and the non-structural protein NSP4 are lost, while the virus surface proteins VP4 and VP7 rearrange to form the outermost virus protein layer, yielding mature infectious triple-layered particles. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available