viHumans
Reviewed
Bandicota Bengalensis (lesser Bandicoot Rat) [TaxID: 69079]; Callithrix [TaxID: 9481]; Cercopithecus Hamlyni (Owl-faced Monkey) (Hamlyn's Monkey) [TaxID: 9536]; Chlorocebus Aethiops (Green Monkey) (Cercopithecus Aethiops) [TaxID: 9534]; Gallus Gallus (Chicken) [TaxID: 9031]; Homo Sapiens (Human) [TaxID: 9606]; Macaca (macaques) [TaxID: 9539]; Mus Musculus (Mouse) [TaxID: 10090]; Pan Troglodytes (Chimpanzee) [TaxID: 9598]; Saimiri (squirrel Monkeys) [TaxID: 9520]; Sus Scrofa (Pig) [TaxID: 9823]
ORF3
Protein ORF3 (pORF3)
Hepatitis E Virus Genotype 1 (isolate Human/Myanmar/HEVNE8L) (HEV-1)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Hepeviridae> Orthohepevirus> Orthohepevirus A> Hepatitis E Virus (HEV)> Hepatitis E Virus Genotype 1 (isolate Human/Myanmar/HEVNE8L) (HEV-1)
Various pathway(s) in which protein is involved
Not Available
Not Available
MGSRPCDLGLFCCCSSCFCLCCPRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPSPPMSPLRPGLDLVFANQPDHSAPLGVTRPSAPP
LPHVVDLPQLGPRR
114
Not Available
Not Available
20-05-2008
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
May act as a viral regulatory protein involved in the modulation of mitogenic signaling pathways. May be involved in virion morphogenesis and viral pathogenesis. Expedites the processing and secretion of AMBP from the hepatocyte (By similarity).
Not Available
Host cytoplasm . Note=The N-terminal region seems to associate with the cytoskeleton probably via one of its hydrophobic regions. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available