viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
BMLF1; BSLF2[Gene ID: 3783758 ]
mRNA export factor ICP27 homolog (Mta) (ORF57 protein homolog) (Protein SM)
Epstein-Barr Virus (strain B95-8) (HHV-4) (Human Herpesvirus 4)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Lymphocryptovirus> Epstein-Barr Virus (strain GD1) (HHV-4) (Human Herpesvirus 4)> Epstein-Barr Virus (strain B95-8) (HHV-4) (Human Herpesvirus 4)
Various pathway(s) in which protein is involved
Not Available
MVPSQRLSRTSSISSNEDPAESHILELEAVSDTNTDCDLDPMEGSEEHSTDGEISSSEEEDEDPTPAHAIPARPSSVVITPTSASFVIPRKKWDLQDKTV
TLHRSPLCRDEDEKEETGNSSYTRGHKRRRGEVHGCTDESYGKRRHLPPGARAPRAPRAPRVPRAPRSPRAPRSNRATRGPRSESRGAGRSTRKQARQER
SQRPLPNKPWFDMSLVKPVSKITFVTLPSPLASLTLEPIQDPFLQSMLAVAAHPEIGAWQKVQPRHELRRSYKTLREFFTKSTNKDTWLDARMQAIQNAG
LCTLVAMLEETIFWLQEITYHGDLPLAPAEDILLACAMSLSKVILTKLKELAPCFLPNTRDYNFVKQLFYITCATARQNKVVETLSSSYVKQPLCLLAAY
AAVAPAYINANCRRRHDEVEFLGHYIKNYNPGTLSSLLTEAVETHTRDCRSASCSRLVRAILSPGTGSLGLFFVPGLNQ
479
Not Available
Not Available
26-05-2009
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Promotes the nuclear export of a subset of early and late viral mRNAs by interacting with mRNAs and cellular export proteins. Additionally may prevent the establishment of cellular antiviral state, by acting as an alternative splicing factor for cellular RNAs such as STAT1, resulting in a STAT1 mRNA incapable of producing the STAT1alpha isoform.
Not Available
GO:0003723  ;   GO:0006351  ;   GO:0006355  ;   GO:0030430  ;   GO:0039502  ;  
GO:0039580  ;   GO:0044095  ;   GO:0046872  ;   GO:0051028  
Host nucleus . Host cytoplasm . Note=shuttles between the nucleus and the cytoplasm.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available