Reviewed
Cercopithecus Hamlyni (Owl-faced Monkey) (Hamlyn's Monkey) [TaxID: 9536]; Homo Sapiens (Human) [TaxID: 9606]; Macaca (macaques) [TaxID: 9539]; Pan Troglodytes (Chimpanzee) [TaxID: 9598]
Not Available
♦Genome polyprotein [Cleaved into: Protein VP0 (VP4-VP2)
♦ Protein VP4 (P1A) (Virion protein 4)
♦ Protein VP2 (P1B) (Virion protein 2)
♦ Protein VP3 (P1C) (Virion protein 3)
♦ Protein VP1-2A (PX)
♦ Protein VP1 (P1D) (Virion protein 1)
♦ Protein 2A] (Fragment)
♦ Protein VP4 (P1A) (Virion protein 4)
♦ Protein VP2 (P1B) (Virion protein 2)
♦ Protein VP3 (P1C) (Virion protein 3)
♦ Protein VP1-2A (PX)
♦ Protein VP1 (P1D) (Virion protein 1)
♦ Protein 2A] (Fragment)
Human Hepatitis A Virus Genotype IIIA (isolate GA76) (HHAV) (Human Hepatitis A Virus (isolate Human/Georgia/GA76/1976))
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Picornavirales> Picornaviridae> Hepatovirus> Hepatovirus A> Human Hepatitis A Virus> Human Hepatitis A Virus Genotype IIIA (isolate GA76) (HHAV) (Human Hepatitis A Virus (isolate Human/Georgia/GA76/1976))
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
LADVEEEQMIQSVDRTAVTGASYFTSVDQSSVHTAEVGSHQPEPLKTSVDKPGSKRTQGEKFFLIHSADWLTTHALFHEVAKLDVVKLLYNEQFAVQGLL
RYHTYARFGIEIQVQINPTPFQQGGLICAMVPGDQSYGSIASLTVYPHGLLNCNINNVVRIKVPFIYTRGAYHFKDPQYPVWELTIRVWSELNIGTGTSA
YTSLNVLARFTDLELHGLTPLSTQMMRNEFRVSTTENVVNLSNYEDARAKMSFALDQEDWKSDASQGGGIKITHFTTWTSIPTLAAQFPFNASDSVGQQI
KVIPVDPYFFQMTNTNPEQKCITALASICQMFCFWRGDLVFDFQVFPTKYHSGRLLFCFVPGNELIDVSHITLKQATTAPCAVMDITGVQSTLRFRVPWI
SDTPYRVNRYTKSSHQKGEYTAIGKLIVYCYNRLTSPSNVASHVRVNVYLSAINLECFAPLYHAMDVTTQVGDDSGGFSTTVSTKQNVPDPQVGITTVKD
LKGRANQGKMDISGVQAPVGAITTIEDPVLAKKVPETFPELKPGESRHTSDHMSIYKFMGRSHFLCTFTFNSNNKEYTFPITLSSTSNPPHGLPATLRWF
FNLFQLYRGPLDLTIIITGATDVDGMAWFTPVGLAVDTPWVEKESALSIDYKTALGAVRFNTRRTGNDQIRLPWYSYLYAVSGALDGLGDKTDSTFGLVS
IQIANYNHSDEYLSFSCYLSVTEQSEFYFPRAPLNTNAMMSSETVMDRIALGDLESSVDDPRTEEDRKFESHIEKRKPYKELRLEVGKQRLKYAQEELSN
EVLPPPRK
RYHTYARFGIEIQVQINPTPFQQGGLICAMVPGDQSYGSIASLTVYPHGLLNCNINNVVRIKVPFIYTRGAYHFKDPQYPVWELTIRVWSELNIGTGTSA
YTSLNVLARFTDLELHGLTPLSTQMMRNEFRVSTTENVVNLSNYEDARAKMSFALDQEDWKSDASQGGGIKITHFTTWTSIPTLAAQFPFNASDSVGQQI
KVIPVDPYFFQMTNTNPEQKCITALASICQMFCFWRGDLVFDFQVFPTKYHSGRLLFCFVPGNELIDVSHITLKQATTAPCAVMDITGVQSTLRFRVPWI
SDTPYRVNRYTKSSHQKGEYTAIGKLIVYCYNRLTSPSNVASHVRVNVYLSAINLECFAPLYHAMDVTTQVGDDSGGFSTTVSTKQNVPDPQVGITTVKD
LKGRANQGKMDISGVQAPVGAITTIEDPVLAKKVPETFPELKPGESRHTSDHMSIYKFMGRSHFLCTFTFNSNNKEYTFPITLSSTSNPPHGLPATLRWF
FNLFQLYRGPLDLTIIITGATDVDGMAWFTPVGLAVDTPWVEKESALSIDYKTALGAVRFNTRRTGNDQIRLPWYSYLYAVSGALDGLGDKTDSTFGLVS
IQIANYNHSDEYLSFSCYLSVTEQSEFYFPRAPLNTNAMMSSETVMDRIALGDLESSVDDPRTEEDRKFESHIEKRKPYKELRLEVGKQRLKYAQEELSN
EVLPPPRK
808
Not Available
Not Available
01-07-1993
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
♦Capsid proteins VP1, VP2, and VP3 form a closed capsid enclosing the viral positive strand RNA genome. All these proteins contain a beta-sheet structure called beta-barrel jelly roll. Together they form an icosahedral capsid (T=3) composed of 60 copies of each VP1, VP2, and VP3, with a diameter of approximately 300 Angstroms. VP1 is situated at the 12 fivefold axes, whereas VP2 and VP3 are located at the quasi-sixfold axes. The capsid interacts with HAVCR1 to provide virion attachment to target cell (By similarity).
♦ Protein VP0: VP0 precursor is a component of immature procapsids. The N-terminal domain of VP0, protein VP4, is needed for the assembly of 12 pentamers into the icosahedral structure. Unlike other picornaviruses, HAV VP4 does not seem to be myristoylated and has not been detected in mature virions, supposedly owing to its small size (By similarity).
♦ VP1-2A precursor is a component of immature procapsids and corresponds to an extended form of the structural protein VP1. The C-terminal domain of VP1-2A, protein 2A, acts as an assembly signal that allows multimerization of VP1-2A and formation of pentamers of VP1-VP2-VP3 trimers. It is proteolytically removed from the precursor by a host protease and does not seem to be found in mature particles (By similarity).
♦ Protein VP0: VP0 precursor is a component of immature procapsids. The N-terminal domain of VP0, protein VP4, is needed for the assembly of 12 pentamers into the icosahedral structure. Unlike other picornaviruses, HAV VP4 does not seem to be myristoylated and has not been detected in mature virions, supposedly owing to its small size (By similarity).
♦ VP1-2A precursor is a component of immature procapsids and corresponds to an extended form of the structural protein VP1. The C-terminal domain of VP1-2A, protein 2A, acts as an assembly signal that allows multimerization of VP1-2A and formation of pentamers of VP1-VP2-VP3 trimers. It is proteolytically removed from the precursor by a host protease and does not seem to be found in mature particles (By similarity).
Not Available
♦ Protein VP2: Virion . Host cytoplasm .
♦ Protein VP3: Virion . Host cytoplasm .
♦ Protein VP1: Virion . Host cytoplasm .
♦ Protein VP1-2A: Virion . Host cytoplasm .
♦ Protein VP3: Virion . Host cytoplasm .
♦ Protein VP1: Virion . Host cytoplasm .
♦ Protein VP1-2A: Virion . Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available