viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Bet
Protein Bet
Human Spumaretrovirus (SFVcpz(hu)) (Human Foamy Virus)
Viruses> Retro-transcribing Viruses> Retroviridae> Spumaretrovirinae> Spumavirus> Simian Foamy Virus> Human Spumaretrovirus (SFVcpz(hu)) (Human Foamy Virus)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MDSYEKEESVASTSGIQDLQTLSELVGPENAGEGELTIAEEPEENPRRPRRYTKREVKCVSYHAYKEIEDKHPQHIKLQDWIPTPEEMIAQKVQNQDLGT
ILSFDVTCLKSITSLGRNDPGDDPSIMSHVLPVVTPWPMSQDHYAPTLFGILDRYYQGYLKSPATYQTWKFTCQVDPSGKRFMETQFWVPPLGQVNIQFY
KNYQILTCCQAVDPFANIFHGTDEEMFDIDSGPDVWCSPSLCFKVIYEGAMGQKQEQKTWLCRLGHGHRMGACDYRKVDLYAMRQGKENPYGDRGDAALQ
YAYQVKRGCKAGCLASPVLNYKALQFHRTIMADFTNPRIGEGHLAHGYQAAMEAYGPQRGSNEERVWWNVTRNQGKQGGEYYREGGEEPHYPNTPAPHRR
TWDERHKVLKLSSFATPSDIQRWTTKALPYGWKVVTESGNDYTSRRKIRTLTEMTQDEIRKRWESGYCDPFIDSGSDSDGPF
482
VAR_SEQ 1 126 Missing (in isoform Bel-2)
Not Available
01-05-1997
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Bet counteracts the innate antiretroviral activity of APOBEC3 family defense factors by inhibiting their incorporation into virions. May be implicated in the establishment and/or maintenance of viral persistance. Bet is required for viral replication (By similarity).
Not Available
GO:0005576  ;   GO:0016032  ;   GO:0030430  ;   GO:0042025  ;   GO:0045893  
♦ Isoform Bet: Host cytoplasm . Host nucleus . Secreted . Note=Bet is highly expressed in infected cells, where it localizes to both cytoplasm and nucleus (). Also secreted and internalized by non-infected surrounding cells ().
♦ Isoform Bel-2: Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available