Reviewed
Homo Sapiens (Human) [TaxID: 9606]
US9[Gene ID: 24271460 ]
Envelope protein US9 (10 kDa protein)
Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 2 (HHV-2) (Human Herpes Simplex Virus 2)> Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Not Available
Various pathway(s) in which protein is involved
Not Available
MTSRPADQDSVRSSASVPLYPAASPVPAEAYYSESEDEAANDFLVRMGRQQSVLRRRRRRTRCVGLVIACLVVALLSGGFGALLVWLLR
89
Not Available
Not Available
01-05-1997
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Essential for the anterograde spread of the infection throughout the host nervous system. Together with the gE/gI heterodimer, US9 is involved in the sorting and transport of viral structural components toward axon tips.
Not Available
♦ Virion membrane
♦ Single-pass type II membrane protein . Host Golgi apparatus membrane
♦ Single-pass type II membrane protein . Host smooth endoplasmic reticulum membrane
♦ Single-pass type II membrane protein . Host cell membrane
♦ Single-pass type II membrane protein . Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN), maybe through an interaction with PACS-1 sorting protein.
♦ Single-pass type II membrane protein . Host Golgi apparatus membrane
♦ Single-pass type II membrane protein . Host smooth endoplasmic reticulum membrane
♦ Single-pass type II membrane protein . Host cell membrane
♦ Single-pass type II membrane protein . Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN), maybe through an interaction with PACS-1 sorting protein.
Not Available
MOTIF 20 23 Internalization motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available